KCC000452A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000452A_C01 KCC000452A_c01
CTTGTTTTAATATACAACGGCATTTGGCTGGTCGAGACCAAAATGTCGTCGACTGCGACC
ATGCCCGGCCAGCGCTCGGCCATGAAGGCCGCTGGCGCCCAGAGCCGCCGTGCCGTGAAG
GTGATGGCCGTGTCCGCTCCGGAGAAGCCGTCGTCGTCCGCCCCGGCCGTCCCGGCAGGC
CTGAACAAGTTCAGCAGCCGCATCACGCAACCCAAGTACCAGGGCGCGTCTCAGGCCATG
CTGTTCGCTACCGGTCTGCGGGAGGAGGACATGATCAAGCCGCAGGTGGGCATCTCCTCG
GTGTGGTACGAGGGCAACCCTTGCAACATGCACCTGATGGACCTGGCGGCGGAGGTGAAG
AAGGGCGTGGAGGCCATGGGCATGGTGGGCTTCCGCTTCAACACCATTGGTGTCAGCGAC
GGCATTTCCATGGGCACCGACGGCATGAGCTTCAGCCTGCAGAGCCGCGACCTGATTGCC
GACTCCATTGAGACGGTCATGAGCGCGCAGTGGTACGACGCCAACATCTCGCTG


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000452A_C01 KCC000452A_c01
         (534 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|NP_870314.1| dihydroxy-acid dehydratase [Pirellula sp.] gi|3...   199  2e-50
ref|NP_593729.1| putative dihydroxy-acid dehydratase precursor [...   191  7e-48
ref|NP_189036.1| dihydroxyacid dehydratase -related [Arabidopsis...   189  1e-47
gb|AAK64025.1| putative dihydroxyacid dehydratase [Arabidopsis t...   189  1e-47
ref|XP_323935.1| hypothetical protein [Neurospora crassa] gi|289...   183  1e-45

>ref|NP_870314.1| dihydroxy-acid dehydratase [Pirellula sp.]
           gi|32447871|emb|CAD77389.1| dihydroxy-acid dehydratase
           [Pirellula sp.]
          Length = 587

 Score =  199 bits (506), Expect = 2e-50
 Identities = 101/138 (73%), Positives = 113/138 (81%)
 Frame = +1

Query: 121 VMAVSAPEKPSSSAPAVPAGLNKFSSRITQPKYQGASQAMLFATGLREEDMIKPQVGISS 300
           +M  S PE  S++       LNK+SS+ITQPK QGASQAML+ATG+  EDM KPQVGI S
Sbjct: 20  LMTASQPESDSNA-------LNKYSSKITQPKSQGASQAMLYATGMSSEDMNKPQVGIGS 72

Query: 301 VWYEGNPCNMHLMDLAAEVKKGVEAMGMVGFRFNTIGVSDGISMGTDGMSFSLQSRDLIA 480
           +WYEGN CNMHL+DLAA+VK GV   GMVG RFNTIGVSDGISMGTDGMSFSLQSRDLIA
Sbjct: 73  MWYEGNSCNMHLLDLAADVKAGVTDAGMVGMRFNTIGVSDGISMGTDGMSFSLQSRDLIA 132

Query: 481 DSIETVMSAQWYDANISL 534
           DSIET+M AQWYDA I+L
Sbjct: 133 DSIETIMGAQWYDALITL 150

>ref|NP_593729.1| putative dihydroxy-acid dehydratase precursor [Schizosaccharomyces
           pombe] gi|1708464|sp|Q10318|ILV3_SCHPO Putative
           dihydroxy-acid dehydratase, mitochondrial precursor
           (DAD) (2,3-dihydroxy acid hydrolyase)
           gi|7492518|pir||T37858 probable dihydroxy-acid
           dehydratase precursor - fission yeast
           (Schizosaccharomyces pombe) gi|1213255|emb|CAA93689.1|
           SPAC17G8.06c [Schizosaccharomyces pombe]
          Length = 598

 Score =  191 bits (484), Expect = 7e-48
 Identities = 97/150 (64%), Positives = 113/150 (74%)
 Frame = +1

Query: 85  KAAGAQSRRAVKVMAVSAPEKPSSSAPAVPAGLNKFSSRITQPKYQGASQAMLFATGLRE 264
           K    Q+  A K  A+S     +SS   V   LNK+S  IT PK QGASQAML+ATGL E
Sbjct: 5   KLLRCQNGIASKRAALSLKGFKTSSINLVEKKLNKYSETITGPKSQGASQAMLYATGLNE 64

Query: 265 EDMIKPQVGISSVWYEGNPCNMHLMDLAAEVKKGVEAMGMVGFRFNTIGVSDGISMGTDG 444
           EDM KPQVGI+S WYEGNPCNMHL+DL   VK+GV+  G+ GF+FNTIGVSDGISMGT G
Sbjct: 65  EDMKKPQVGIASCWYEGNPCNMHLLDLGRRVKEGVKKAGLTGFQFNTIGVSDGISMGTTG 124

Query: 445 MSFSLQSRDLIADSIETVMSAQWYDANISL 534
           M +SLQSR++IADSIETVM  QWYDAN+S+
Sbjct: 125 MRYSLQSREIIADSIETVMQGQWYDANVSI 154

>ref|NP_189036.1| dihydroxyacid dehydratase -related [Arabidopsis thaliana]
           gi|9294662|dbj|BAB03011.1| dihydroxy-acid dehydratase
           [Arabidopsis thaliana]
           gi|17933301|gb|AAL48233.1|AF446360_1 AT3g23940/F14O13_13
           [Arabidopsis thaliana] gi|24030434|gb|AAN41372.1|
           putative dihydroxyacid dehydratase [Arabidopsis
           thaliana]
          Length = 608

 Score =  189 bits (481), Expect = 1e-47
 Identities = 100/168 (59%), Positives = 122/168 (72%), Gaps = 2/168 (1%)
 Frame = +1

Query: 37  TKMSSTATMPGQRSAMKAAGAQSRRAVKVMAVSAPEKPSSSAPAVPAG--LNKFSSRITQ 210
           T  S  AT+   +  + +    SRR   +++ SA    +  +P +     LNK+SSRIT+
Sbjct: 4   TIFSPRATLFPCKPLLPSHNVNSRRP-SIISCSAQSVTADPSPPITDTNKLNKYSSRITE 62

Query: 211 PKYQGASQAMLFATGLREEDMIKPQVGISSVWYEGNPCNMHLMDLAAEVKKGVEAMGMVG 390
           PK QG SQA+L   GL ++D++KPQ+GISSVWYEGN CNMHL+ L+  VK+GVE  GMVG
Sbjct: 63  PKSQGGSQAILHGVGLSDDDLLKPQIGISSVWYEGNTCNMHLLKLSEAVKEGVENAGMVG 122

Query: 391 FRFNTIGVSDGISMGTDGMSFSLQSRDLIADSIETVMSAQWYDANISL 534
           FRFNTIGVSD ISMGT GM FSLQSRDLIADSIETVMSAQWYD NIS+
Sbjct: 123 FRFNTIGVSDAISMGTRGMCFSLQSRDLIADSIETVMSAQWYDGNISI 170

>gb|AAK64025.1| putative dihydroxyacid dehydratase [Arabidopsis thaliana]
          Length = 608

 Score =  189 bits (481), Expect = 1e-47
 Identities = 100/168 (59%), Positives = 122/168 (72%), Gaps = 2/168 (1%)
 Frame = +1

Query: 37  TKMSSTATMPGQRSAMKAAGAQSRRAVKVMAVSAPEKPSSSAPAVPAG--LNKFSSRITQ 210
           T  S  AT+   +  + +    SRR   +++ SA    +  +P +     LNK+SSRIT+
Sbjct: 4   TIFSPRATLFPCKPLLPSHNVNSRRP-SIISCSAQSVTADPSPPITDTNKLNKYSSRITE 62

Query: 211 PKYQGASQAMLFATGLREEDMIKPQVGISSVWYEGNPCNMHLMDLAAEVKKGVEAMGMVG 390
           PK QG SQA+L   GL ++D++KPQ+GISSVWYEGN CNMHL+ L+  VK+GVE  GMVG
Sbjct: 63  PKSQGGSQAILHGVGLSDDDLLKPQIGISSVWYEGNTCNMHLLKLSEAVKEGVENAGMVG 122

Query: 391 FRFNTIGVSDGISMGTDGMSFSLQSRDLIADSIETVMSAQWYDANISL 534
           FRFNTIGVSD ISMGT GM FSLQSRDLIADSIETVMSAQWYD NIS+
Sbjct: 123 FRFNTIGVSDAISMGTRGMCFSLQSRDLIADSIETVMSAQWYDGNISI 170

>ref|XP_323935.1| hypothetical protein [Neurospora crassa] gi|28919625|gb|EAA29044.1|
           hypothetical protein [Neurospora crassa]
           gi|28950019|emb|CAD70774.1| probable dihydroxy-acid
           dehydratase [Neurospora crassa]
          Length = 596

 Score =  183 bits (464), Expect = 1e-45
 Identities = 90/118 (76%), Positives = 101/118 (85%)
 Frame = +1

Query: 181 LNKFSSRITQPKYQGASQAMLFATGLREEDMIKPQVGISSVWYEGNPCNMHLMDLAAEVK 360
           LNK S+ ITQPK QGASQAML+ATGL E+DM K QVGISSVWYEGNPCNMHL+DL+  VK
Sbjct: 39  LNKVSANITQPKSQGASQAMLYATGLNEDDMNKAQVGISSVWYEGNPCNMHLLDLSGLVK 98

Query: 361 KGVEAMGMVGFRFNTIGVSDGISMGTDGMSFSLQSRDLIADSIETVMSAQWYDANISL 534
           + V   G+V  RFNTIGVSDGISMGT GM +SLQSR++IADSIETVM+ QWYDANISL
Sbjct: 99  ESVAKAGLVPMRFNTIGVSDGISMGTTGMRYSLQSREIIADSIETVMNGQWYDANISL 156



EST assemble image


clone accession position
1 MX254h06_r BP092492 1 609
2 HCL069c11_r AV643416 97 662
3 CL30h07_r AV394758 100 640
4 HC070b09_r AV637207 100 555
5 MXL003c07_r BP093093 100 482
6 HCL029d10_r AV641188 101 646
7 HCL014f11_r AV640348 101 641
8 MX242c08_r BP091655 104 489
9 MXL067g06_r BP096959 113 514
10 MX209e02_r BP089546 114 581
11 HCL071g01_r AV643560 117 663
12 HCL096h08_r AV645008 141 513




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research