KCC000449A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000449A_C01 KCC000449A_c01
CCATTTCAAAGCAGAGCAGCAGACGCGATACCAGGTTGCCGACCACTGCTCCACTCGAGA
GTGACTCTTGTTTGGTCCAAACTCATCGTGCTCCACTCGAGAGTGACTCTTGTTTTGTCC
AAAATCATCGTAAGCAGCTGATCGCCTCGTTGCAAGCTTCCGCGTCGTTGTAAATGGACC
CAGCGAAGATTCGCCCCTCGTCCGCGTACAACACCCCCTACTGGACCACCAACAGCGGTG
CGCCGGTATGGAACAACAACAACTCCATGACAGTGGGGACGCGCGGTCCCATCCTCCTGG
AGGACTACCACCTGGTTGAGAAGCTGGCGCAGTTCGACCGGGAGCGCATCCCCGAGCGCG
TCGTGCACGCCCGCGGCGCTGCGGCAAAGGGCTTCTTCGAGGTGACGCACGACATCTCAG
CCCTGACGGCGGCCGACTTCCTGCGCGCGCCGGGCGTGCAGACGCCCGTCATCGTGCGCT
TCTCCACTGTGGTGCACGAGCGCGGCTCGCCCGAGACCCTCCGCGACCCTCGCGGCTTCG
CGGTCAAGTTCTACACACGTGAGGGCAATTTCGACATGGTCGGCAACAACATGCCGGTGT
TCTTCATCCGCGACGGCATGAAGTTCCCGGACATGGTTCACGCCTTCAAGCCCAACCCCA
AGAGCCACATCCAGGAGGCCTGGCGCATTATGGACTTCCTGTCGCACCACCCCGAGTCAT
GCCACATGCTGACGTTCCTGCTGGACGACGCCGGCATCCCGCTCAACTACCGCCACATGC
CGGGCTTTGGCGTGCACACCATGAAGCTGATCAACAAGGCCGGCCGCGAGACGTATGTCA
AGTTCCACTGGGTGCCCAAGTGCGGCGAGAAGTACCTGCTGGACGACGAGGCGGTGATGG
TGGGCGGAGCCAACCACAGCCACGCCACCAAGGACCTGTTCGACGCCATCGCAGCGGGCG
ACTACCCGGAGTGGGCGCTCATGGTACAGACCATGGACCCCGCGGACGAGGACAAGTTTG
ACTTTGACCCTCTGGACGTGACCAAGACCTGGCCCGAGTCGCTGTTCCCCATGCAGCCGG
TGGGCCGCATGGTGCTCAACCGCAACGTGGACAACTTCTTCAACGAGAATGAGCAGGTGG
CCTTCTGCCCCGCCATCATCGTGCCGGGCATCGGCTACAGCGATGACAAGCTGCTGCAGA
CGCGCATCTTCTCCTACGCCGACACGCAGCGGCACCGGCTGGGCCCCAACTACCTACTGC
TGCCGGTGAACGCGCCGCGCGCCCCCCACCACAACAACCACCACGAGGGCTTCATGAACT
TCATGCACCGCGACGAGGAAATCAACTACTTCCCCAGCAGGTTTGACCCGG


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000449A_C01 KCC000449A_c01
         (1371 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

pir||T07911 catalase (EC 1.11.1.6) - Chlamydomonas reinhardtii g...   844  0.0
emb|CAA73663.1| catalase [Chlamydomonas reinhardtii]                  834  0.0
gb|AAF19965.1|AF207906_1 catalase 1 [Zantedeschia aethiopica]         721  0.0
emb|CAD42908.1| catalase [Prunus persica]                             719  0.0
sp|P30567|CAT2_GOSHI Catalase isozyme 2 gi|99599|pir||S17493 cat...   718  0.0

>pir||T07911 catalase (EC 1.11.1.6) - Chlamydomonas reinhardtii
            gi|2388691|gb|AAB70006.1| catalase [Chlamydomonas
            reinhardtii]
          Length = 493

 Score =  844 bits (2181), Expect = 0.0
 Identities = 399/399 (100%), Positives = 399/399 (100%)
 Frame = +3

Query: 174  MDPAKIRPSSAYNTPYWTTNSGAPVWNNNNSMTVGTRGPILLEDYHLVEKLAQFDRERIP 353
            MDPAKIRPSSAYNTPYWTTNSGAPVWNNNNSMTVGTRGPILLEDYHLVEKLAQFDRERIP
Sbjct: 1    MDPAKIRPSSAYNTPYWTTNSGAPVWNNNNSMTVGTRGPILLEDYHLVEKLAQFDRERIP 60

Query: 354  ERVVHARGAAAKGFFEVTHDISALTAADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR 533
            ERVVHARGAAAKGFFEVTHDISALTAADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR
Sbjct: 61   ERVVHARGAAAKGFFEVTHDISALTAADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR 120

Query: 534  GFAVKFYTREGNFDMVGNNMPVFFIRDGMKFPDMVHAFKPNPKSHIQEAWRIMDFLSHHP 713
            GFAVKFYTREGNFDMVGNNMPVFFIRDGMKFPDMVHAFKPNPKSHIQEAWRIMDFLSHHP
Sbjct: 121  GFAVKFYTREGNFDMVGNNMPVFFIRDGMKFPDMVHAFKPNPKSHIQEAWRIMDFLSHHP 180

Query: 714  ESCHMLTFLLDDAGIPLNYRHMPGFGVHTMKLINKAGRETYVKFHWVPKCGEKYLLDDEA 893
            ESCHMLTFLLDDAGIPLNYRHMPGFGVHTMKLINKAGRETYVKFHWVPKCGEKYLLDDEA
Sbjct: 181  ESCHMLTFLLDDAGIPLNYRHMPGFGVHTMKLINKAGRETYVKFHWVPKCGEKYLLDDEA 240

Query: 894  VMVGGANHSHATKDLFDAIAAGDYPEWALMVQTMDPADEDKFDFDPLDVTKTWPESLFPM 1073
            VMVGGANHSHATKDLFDAIAAGDYPEWALMVQTMDPADEDKFDFDPLDVTKTWPESLFPM
Sbjct: 241  VMVGGANHSHATKDLFDAIAAGDYPEWALMVQTMDPADEDKFDFDPLDVTKTWPESLFPM 300

Query: 1074 QPVGRMVLNRNVDNFFNENEQVAFCPAIIVPGIGYSDDKLLQTRIFSYADTQRHRLGPNY 1253
            QPVGRMVLNRNVDNFFNENEQVAFCPAIIVPGIGYSDDKLLQTRIFSYADTQRHRLGPNY
Sbjct: 301  QPVGRMVLNRNVDNFFNENEQVAFCPAIIVPGIGYSDDKLLQTRIFSYADTQRHRLGPNY 360

Query: 1254 LLLPVNAPRAPHHNNHHEGFMNFMHRDEEINYFPSRFDP 1370
            LLLPVNAPRAPHHNNHHEGFMNFMHRDEEINYFPSRFDP
Sbjct: 361  LLLPVNAPRAPHHNNHHEGFMNFMHRDEEINYFPSRFDP 399

>emb|CAA73663.1| catalase [Chlamydomonas reinhardtii]
          Length = 492

 Score =  834 bits (2154), Expect = 0.0
 Identities = 395/399 (98%), Positives = 396/399 (98%)
 Frame = +3

Query: 174  MDPAKIRPSSAYNTPYWTTNSGAPVWNNNNSMTVGTRGPILLEDYHLVEKLAQFDRERIP 353
            MDPAKIRPSSAYNTPYWTTNSGAPVWNNNNSMTVGTRGPILLEDYHLVEKLAQFDRERIP
Sbjct: 1    MDPAKIRPSSAYNTPYWTTNSGAPVWNNNNSMTVGTRGPILLEDYHLVEKLAQFDRERIP 60

Query: 354  ERVVHARGAAAKGFFEVTHDISALTAADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR 533
            ERVVHARGAAAKGFFEVTHDISALTAADFL APGVQTPVIVRFSTVVHERGSPETLRDPR
Sbjct: 61   ERVVHARGAAAKGFFEVTHDISALTAADFLPAPGVQTPVIVRFSTVVHERGSPETLRDPR 120

Query: 534  GFAVKFYTREGNFDMVGNNMPVFFIRDGMKFPDMVHAFKPNPKSHIQEAWRIMDFLSHHP 713
            GFAVKFYTREGNFDMVGNNMPVFFIRDGMKFPDMVHAFKPNPKSHIQEAWRIMDFLSHHP
Sbjct: 121  GFAVKFYTREGNFDMVGNNMPVFFIRDGMKFPDMVHAFKPNPKSHIQEAWRIMDFLSHHP 180

Query: 714  ESCHMLTFLLDDAGIPLNYRHMPGFGVHTMKLINKAGRETYVKFHWVPKCGEKYLLDDEA 893
            ESCHMLTFLLDDAGIPLNYRHMPGFGVHTMKLINKAGRETYVKFHWVPKCGEKYLLDDEA
Sbjct: 181  ESCHMLTFLLDDAGIPLNYRHMPGFGVHTMKLINKAGRETYVKFHWVPKCGEKYLLDDEA 240

Query: 894  VMVGGANHSHATKDLFDAIAAGDYPEWALMVQTMDPADEDKFDFDPLDVTKTWPESLFPM 1073
            VMVG +NHSHATKDLFDAIAAGDYPEWALMVQTMDPADEDKFDFDPLDVTKTWPESLFPM
Sbjct: 241  VMVGRSNHSHATKDLFDAIAAGDYPEWALMVQTMDPADEDKFDFDPLDVTKTWPESLFPM 300

Query: 1074 QPVGRMVLNRNVDNFFNENEQVAFCPAIIVPGIGYSDDKLLQTRIFSYADTQRHRLGPNY 1253
            QPVGRMVLNRNVDNFFNENEQVAFCPAIIVPGIGYSDDKLLQTRIFSYADTQRHRL PNY
Sbjct: 301  QPVGRMVLNRNVDNFFNENEQVAFCPAIIVPGIGYSDDKLLQTRIFSYADTQRHRLVPNY 360

Query: 1254 LLLPVNAPRAPHHNNHHEGFMNFMHRDEEINYFPSRFDP 1370
            LLLPVNAPRAPHHNNHHEGFMNFMHRDEEINYFPSRFDP
Sbjct: 361  LLLPVNAPRAPHHNNHHEGFMNFMHRDEEINYFPSRFDP 399

>gb|AAF19965.1|AF207906_1 catalase 1 [Zantedeschia aethiopica]
          Length = 492

 Score =  721 bits (1862), Expect = 0.0
 Identities = 331/399 (82%), Positives = 361/399 (89%)
 Frame = +3

Query: 174  MDPAKIRPSSAYNTPYWTTNSGAPVWNNNNSMTVGTRGPILLEDYHLVEKLAQFDRERIP 353
            MDP + RPSSA+N+P+WTTNSGAPVWNNNNS+TVG RGPILLEDYHL+EKLAQFDRERIP
Sbjct: 1    MDPYRQRPSSAFNSPFWTTNSGAPVWNNNNSLTVGARGPILLEDYHLLEKLAQFDRERIP 60

Query: 354  ERVVHARGAAAKGFFEVTHDISALTAADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR 533
            ERVVHARGA+AKGFFEVTHD+S LT ADFLRAPGVQTPVIVRFSTV+HERGSPETLRDPR
Sbjct: 61   ERVVHARGASAKGFFEVTHDVSHLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR 120

Query: 534  GFAVKFYTREGNFDMVGNNMPVFFIRDGMKFPDMVHAFKPNPKSHIQEAWRIMDFLSHHP 713
            GFAVKFYTREGNFD+VGNN PVFFIRDG+KFPDMVHA KPNPK+HIQE WRI+DF SHHP
Sbjct: 121  GFAVKFYTREGNFDLVGNNFPVFFIRDGIKFPDMVHALKPNPKTHIQENWRILDFFSHHP 180

Query: 714  ESCHMLTFLLDDAGIPLNYRHMPGFGVHTMKLINKAGRETYVKFHWVPKCGEKYLLDDEA 893
            ES HM TFL DD GIP +YRHM G GVHT  L++K G+  YVKFHW P CG K LLDDEA
Sbjct: 181  ESLHMFTFLFDDIGIPTDYRHMDGSGVHTYTLVSKEGKAHYVKFHWKPTCGVKSLLDDEA 240

Query: 894  VMVGGANHSHATKDLFDAIAAGDYPEWALMVQTMDPADEDKFDFDPLDVTKTWPESLFPM 1073
            V+VGGANHSHATKDL DAIAAG+YPEW L +Q MDP  ED+FDFDPLDVTKTWPE + P+
Sbjct: 241  VVVGGANHSHATKDLTDAIAAGNYPEWKLYIQIMDPDHEDRFDFDPLDVTKTWPEDILPL 300

Query: 1074 QPVGRMVLNRNVDNFFNENEQVAFCPAIIVPGIGYSDDKLLQTRIFSYADTQRHRLGPNY 1253
            QPVGRMVLN+N+DNFF ENEQ+AFCPAIIVPGI YSDDKLLQTRIFSYADTQRHRLGPNY
Sbjct: 301  QPVGRMVLNKNIDNFFAENEQLAFCPAIIVPGIYYSDDKLLQTRIFSYADTQRHRLGPNY 360

Query: 1254 LLLPVNAPRAPHHNNHHEGFMNFMHRDEEINYFPSRFDP 1370
            L+LP NAP+  HHNNHHEGFMNFMHRDEE+NYFPSR+DP
Sbjct: 361  LMLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDP 399

>emb|CAD42908.1| catalase [Prunus persica]
          Length = 492

 Score =  719 bits (1857), Expect = 0.0
 Identities = 327/399 (81%), Positives = 363/399 (90%)
 Frame = +3

Query: 174  MDPAKIRPSSAYNTPYWTTNSGAPVWNNNNSMTVGTRGPILLEDYHLVEKLAQFDRERIP 353
            MDP K RPSSA+++P+WTTNSGAPVWNNN+S+TVG+RGPILLEDYHLVEKLA FDRERIP
Sbjct: 1    MDPYKYRPSSAFDSPFWTTNSGAPVWNNNSSLTVGSRGPILLEDYHLVEKLANFDRERIP 60

Query: 354  ERVVHARGAAAKGFFEVTHDISALTAADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR 533
            ERVVHARGA+AKGFFEVTHDIS LT ADFLRAPGVQTPVIVRFSTV+HERGSPETLRDPR
Sbjct: 61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPVIVRFSTVIHERGSPETLRDPR 120

Query: 534  GFAVKFYTREGNFDMVGNNMPVFFIRDGMKFPDMVHAFKPNPKSHIQEAWRIMDFLSHHP 713
            GFAVKFYTREGNFD+VGNN PVFF+RDGMKFPDMVHA KPNPKSHIQE WRI+DF SHHP
Sbjct: 121  GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQEPWRILDFFSHHP 180

Query: 714  ESCHMLTFLLDDAGIPLNYRHMPGFGVHTMKLINKAGRETYVKFHWVPKCGEKYLLDDEA 893
            ES HM TFL DD G+P +YRHM G GV+T  LINKAG+  YVKFHW P CG K LL+DEA
Sbjct: 181  ESLHMFTFLFDDLGVPQDYRHMEGSGVNTYTLINKAGKAQYVKFHWKPTCGVKCLLEDEA 240

Query: 894  VMVGGANHSHATKDLFDAIAAGDYPEWALMVQTMDPADEDKFDFDPLDVTKTWPESLFPM 1073
            + VGGANHSHATKDL+D+IAAG+YPEW L +QT+DP  ED+FDFDPLDVTKTWPE + P+
Sbjct: 241  IKVGGANHSHATKDLYDSIAAGNYPEWKLYIQTIDPDHEDRFDFDPLDVTKTWPEDILPL 300

Query: 1074 QPVGRMVLNRNVDNFFNENEQVAFCPAIIVPGIGYSDDKLLQTRIFSYADTQRHRLGPNY 1253
            QPVGR+VLN+N+DNFF ENEQ+AFCPAI+VPG+ YSDDKLLQTRIFSY+DTQRHRLGPNY
Sbjct: 301  QPVGRLVLNKNIDNFFAENEQLAFCPAIVVPGVYYSDDKLLQTRIFSYSDTQRHRLGPNY 360

Query: 1254 LLLPVNAPRAPHHNNHHEGFMNFMHRDEEINYFPSRFDP 1370
            L LPVNAP+  HHNNHHEGFMNFMHRDEE+NYFPSR+DP
Sbjct: 361  LQLPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDP 399

>sp|P30567|CAT2_GOSHI Catalase isozyme 2 gi|99599|pir||S17493 catalase (EC 1.11.1.6) -
            upland cotton gi|18488|emb|CAA39998.1| subunit 2 of
            cotton catalase [Gossypium hirsutum]
          Length = 492

 Score =  718 bits (1853), Expect = 0.0
 Identities = 326/399 (81%), Positives = 361/399 (89%)
 Frame = +3

Query: 174  MDPAKIRPSSAYNTPYWTTNSGAPVWNNNNSMTVGTRGPILLEDYHLVEKLAQFDRERIP 353
            MDP K RPSS++++P+WTTNSGAPVWNNN+S+TVG RGPILLEDYHLVEKLA FDRERIP
Sbjct: 1    MDPYKFRPSSSFDSPFWTTNSGAPVWNNNSSLTVGARGPILLEDYHLVEKLANFDRERIP 60

Query: 354  ERVVHARGAAAKGFFEVTHDISALTAADFLRAPGVQTPVIVRFSTVVHERGSPETLRDPR 533
            ERVVHARGA+AKGFFEVTHDIS LT ADFLRAPGVQTP+IVRFSTV+HERGSPETLRDPR
Sbjct: 61   ERVVHARGASAKGFFEVTHDISQLTCADFLRAPGVQTPLIVRFSTVIHERGSPETLRDPR 120

Query: 534  GFAVKFYTREGNFDMVGNNMPVFFIRDGMKFPDMVHAFKPNPKSHIQEAWRIMDFLSHHP 713
            GFAVKFYTREGNFD+VGNN PVFFIRDGMKFPDMVHA KPNPKSHIQE WRI+DF SHHP
Sbjct: 121  GFAVKFYTREGNFDLVGNNFPVFFIRDGMKFPDMVHALKPNPKSHIQENWRILDFFSHHP 180

Query: 714  ESCHMLTFLLDDAGIPLNYRHMPGFGVHTMKLINKAGRETYVKFHWVPKCGEKYLLDDEA 893
            ES HM TFL DD G+P +YRHM G GVHT  LINKAG+  YVKFHW P CG K LL+DEA
Sbjct: 181  ESLHMFTFLFDDIGVPQDYRHMDGSGVHTYTLINKAGKSHYVKFHWKPTCGVKSLLEDEA 240

Query: 894  VMVGGANHSHATKDLFDAIAAGDYPEWALMVQTMDPADEDKFDFDPLDVTKTWPESLFPM 1073
            + VGGANHSHAT+DL+D+IAAG+YPEW L +Q MDP  ED+FDFDPLDVTKTWPE +FP+
Sbjct: 241  IRVGGANHSHATQDLYDSIAAGNYPEWKLFIQIMDPLHEDRFDFDPLDVTKTWPEDIFPL 300

Query: 1074 QPVGRMVLNRNVDNFFNENEQVAFCPAIIVPGIGYSDDKLLQTRIFSYADTQRHRLGPNY 1253
            QP+GRMVLN+N+DNFF ENEQ+AFCP++IVPGI YSDDKLLQTRIFSY+DTQRHRLGPNY
Sbjct: 301  QPMGRMVLNKNIDNFFAENEQLAFCPSLIVPGIYYSDDKLLQTRIFSYSDTQRHRLGPNY 360

Query: 1254 LLLPVNAPRAPHHNNHHEGFMNFMHRDEEINYFPSRFDP 1370
            L LP NAP+  HHNNHHEGFMNFMHRDEE+NYFPSR+DP
Sbjct: 361  LQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDP 399



EST assemble image


clone accession position
1 MX221g05_r BP090300 1 534
2 CL43c12_r AV395512 48 541
3 MXL062h07_r BP096678 60 536
4 LCL060a09_r AV629510 104 579
5 HC007a12_r AV632351 104 622
6 LCL100g02_r AV631845 108 543
7 LC043f06_r AV621992 108 632
8 CM017h08_r AV388160 112 651
9 CM063b04_r AV390072 112 700
10 MX226h11_r BP090644 119 406
11 CM069a07_r AV391235 120 678
12 MXL044g09_r BP095624 126 576
13 HCL036c06_r AV641558 126 593
14 CM075c03_r AV391624 126 720
15 HCL049g05_r AV642325 126 621
16 CL30d04_r AV394733 126 640
17 HC025c11_r AV633794 163 696
18 CM093d09_r AV393002 360 909
19 CM021h09_r AV387910 773 1368
20 MX221g10_r BP090305 778 1084
21 MXL084d12_r BP097974 878 1237
22 HC075h03_r AV637655 909 1344
23 MX235e10_r BP091220 996 1390
24 CM084h12_r AV392626 1174 1491




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research