KCC000448A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000448A_C01 KCC000448A_c01
atcaaaaatggcccttcagTCCCTTCGTGGTCGTTCTGCCTTCTCCAGCGGCCGGGCTGC
ACCCAAGGCATTCGCTCGCGTCCAGCGCACTTGCCGGGCCGCGAGCGTGGTTGCTTCGGC
GACCGCGGTGAAGGCGCCATCGCTGCCCTACCGCGTTGGGCACGGCTTTGACCTGCACCG
CCTGGCGGAGGGGTACAAGCTCATTATTGGCGGTATCGACATCCCCCACACCAAGGGCTG
CGAGGCCCACTCCGATGGCGACGTGCTGCTGCACACCGTGACGGACGCTATCCTCGGCGC
TCTGTGCCTCCCAGACATCGGCCAGCTGTTCCCAGACACGGACCCCAAGTGGAAGGGCGC
CCGCTCGGACATCTTCCTTAAGGAGGCGGTCCGGCTGATGGATGAGAAGGGTTACGTGCT
GGGGAACCTGGACTGCACCATCATCGCGCAGAAGCCCAAGCTGTCGCCCCACAAGGAGAA
CATCCGCAACAACCTGAGTGCCATCCTGGGCGCTGACCCCTCCGTTGTCAACATCAAGGC
CAAGACGCACGAGAAG


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000448A_C01 KCC000448A_c01
         (556 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

gb|AAM62786.1| 2C-methyl-D-erythritol 2,4-cyclodiphosphate synth...   238  5e-62
ref|NP_850971.1| 2C-methyl-D-erythritol 2,4-cyclodiphosphate syn...   236  1e-61
sp|Q9M4W3|ISPF_CATRO 2-C-methyl-D-erythritol 2,4-cyclodiphosphat...   231  6e-60
gb|AAG35071.1|AF321531_1 2C-methyl-D-erythritol 2,4-cyclodiphosp...   216  2e-55
ref|NP_564819.2| 2C-methyl-D-erythritol 2,4-cyclodiphosphate syn...   216  2e-55

>gb|AAM62786.1| 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [Arabidopsis
           thaliana]
          Length = 231

 Score =  238 bits (606), Expect = 5e-62
 Identities = 115/162 (70%), Positives = 131/162 (79%), Gaps = 1/162 (0%)
 Frame = +2

Query: 74  ARVQRTCRAASVVASATAVK-APSLPYRVGHGFDLHRLAEGYKLIIGGIDIPHTKGCEAH 250
           A V     A  V  S T+ K   +LP+R+GHGFDLHRL  GY LIIGGIDIPH +GCEAH
Sbjct: 49  ASVSAASSAVDVNESVTSEKPTKTLPFRIGHGFDLHRLEPGYPLIIGGIDIPHDRGCEAH 108

Query: 251 SDGDVLLHTVTDAILGALCLPDIGQLFPDTDPKWKGARSDIFLKEAVRLMDEKGYVLGNL 430
           SDGDVLLH V DAILGAL LPDIGQ+FPD+DPKWKGA S +F+KEAVRLMDE GY + NL
Sbjct: 109 SDGDVLLHCVVDAILGALGLPDIGQIFPDSDPKWKGAASSVFIKEAVRLMDEAGYEIANL 168

Query: 431 DCTIIAQKPKLSPHKENIRNNLSAILGADPSVVNIKAKTHEK 556
           D T+I Q+PK+SPHKE IR+NLS +LGADPSVVN+KAKTHEK
Sbjct: 169 DATLILQRPKISPHKETIRSNLSKLLGADPSVVNLKAKTHEK 210

>ref|NP_850971.1| 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (ispF); gene
           for chloroplast product [Arabidopsis thaliana]
           gi|27805483|sp|Q9CAK8|ISPF_ARATH 2-C-methyl-D-erythritol
           2,4-cyclodiphosphate synthase, chloroplast precursor
           (MECPS) (MECDP-synthase) gi|25404461|pir||H96664 unknown
           protein, 376-1789 [imported] - Arabidopsis thaliana
           gi|12325003|gb|AAG52445.1|AC010852_2 unknown protein;
           376-1789 [Arabidopsis thaliana]
           gi|13877783|gb|AAK43969.1|AF370154_1 unknown protein
           [Arabidopsis thaliana] gi|16323416|gb|AAL15202.1|
           unknown protein [Arabidopsis thaliana]
          Length = 231

 Score =  236 bits (603), Expect = 1e-61
 Identities = 115/162 (70%), Positives = 131/162 (79%), Gaps = 1/162 (0%)
 Frame = +2

Query: 74  ARVQRTCRAASVVASATAVK-APSLPYRVGHGFDLHRLAEGYKLIIGGIDIPHTKGCEAH 250
           A V     A  V  S T+ K   +LP+R+GHGFDLHRL  GY LIIGGI IPH +GCEAH
Sbjct: 49  ASVSAASSAVDVNESVTSEKPTKTLPFRIGHGFDLHRLEPGYPLIIGGIVIPHDRGCEAH 108

Query: 251 SDGDVLLHTVTDAILGALCLPDIGQLFPDTDPKWKGARSDIFLKEAVRLMDEKGYVLGNL 430
           SDGDVLLH V DAILGAL LPDIGQ+FPD+DPKWKGA S +F+KEAVRLMDE GY +GNL
Sbjct: 109 SDGDVLLHCVVDAILGALGLPDIGQIFPDSDPKWKGAASSVFIKEAVRLMDEAGYEIGNL 168

Query: 431 DCTIIAQKPKLSPHKENIRNNLSAILGADPSVVNIKAKTHEK 556
           D T+I Q+PK+SPHKE IR+NLS +LGADPSVVN+KAKTHEK
Sbjct: 169 DATLILQRPKISPHKETIRSNLSKLLGADPSVVNLKAKTHEK 210

>sp|Q9M4W3|ISPF_CATRO 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase, chloroplast
           precursor (MECPS) (MECDP-synthase)
           gi|7621712|gb|AAF65155.1|AF250236_1
           2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
           [Catharanthus roseus]
          Length = 236

 Score =  231 bits (588), Expect = 6e-60
 Identities = 120/188 (63%), Positives = 133/188 (69%), Gaps = 14/188 (7%)
 Frame = +2

Query: 35  SAFSSGRAAPKAFARVQRTCRAASVVASATAVKA------------PS--LPYRVGHGFD 172
           S     +  P       R  R  S+V SA A  A            PS  L +RVGHGFD
Sbjct: 28  SPVGGSKTTPSYIRLSTRQSRTLSLVVSAAASGAAVEAEPKFAAVTPSKILSFRVGHGFD 87

Query: 173 LHRLAEGYKLIIGGIDIPHTKGCEAHSDGDVLLHTVTDAILGALCLPDIGQLFPDTDPKW 352
           LHRL  GY LIIGGI+IPH +GCEAHSDGDVLLH V DAILGAL LPDIGQ+FPDTDPKW
Sbjct: 88  LHRLEPGYPLIIGGINIPHDRGCEAHSDGDVLLHCVVDAILGALGLPDIGQIFPDTDPKW 147

Query: 353 KGARSDIFLKEAVRLMDEKGYVLGNLDCTIIAQKPKLSPHKENIRNNLSAILGADPSVVN 532
           KGA S +F+KEAVRLMDE GY LGNLD T+I Q+PK+SPHKE IR NL  +LGADP VVN
Sbjct: 148 KGAPSSVFIKEAVRLMDEAGYELGNLDATLILQRPKVSPHKEAIRQNLCQLLGADPCVVN 207

Query: 533 IKAKTHEK 556
           +KAKTHEK
Sbjct: 208 LKAKTHEK 215

>gb|AAG35071.1|AF321531_1 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase [Arabidopsis
           thaliana]
          Length = 223

 Score =  216 bits (550), Expect = 2e-55
 Identities = 108/162 (66%), Positives = 124/162 (75%), Gaps = 1/162 (0%)
 Frame = +2

Query: 74  ARVQRTCRAASVVASATAVK-APSLPYRVGHGFDLHRLAEGYKLIIGGIDIPHTKGCEAH 250
           A V     A  V  S T+ K   +LP+R+GHGFDLHRL  GY LIIGGIDIPH +GCEAH
Sbjct: 49  ASVSAASSAVDVNESVTSEKPTKTLPFRIGHGFDLHRLEPGYPLIIGGIDIPHDRGCEAH 108

Query: 251 SDGDVLLHTVTDAILGALCLPDIGQLFPDTDPKWKGARSDIFLKEAVRLMDEKGYVLGNL 430
           SD         DAILGAL LPDIGQ+FPD+DPKWK A S +F+KEAVRLMDE GY +GNL
Sbjct: 109 SD--------VDAILGALGLPDIGQIFPDSDPKWKEAASSVFIKEAVRLMDEAGYEIGNL 160

Query: 431 DCTIIAQKPKLSPHKENIRNNLSAILGADPSVVNIKAKTHEK 556
           D T+I Q+PK+SPHKE IR+NLS +LGADPSVVN+KAKTHEK
Sbjct: 161 DATLILQRPKISPHKETIRSNLSKLLGADPSVVNLKAKTHEK 202

>ref|NP_564819.2| 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (ispF); gene
           for chloroplast product [Arabidopsis thaliana]
          Length = 223

 Score =  216 bits (549), Expect = 2e-55
 Identities = 108/162 (66%), Positives = 124/162 (75%), Gaps = 1/162 (0%)
 Frame = +2

Query: 74  ARVQRTCRAASVVASATAVK-APSLPYRVGHGFDLHRLAEGYKLIIGGIDIPHTKGCEAH 250
           A V     A  V  S T+ K   +LP+R+GHGFDLHRL  GY LIIGGI IPH +GCEAH
Sbjct: 49  ASVSAASSAVDVNESVTSEKPTKTLPFRIGHGFDLHRLEPGYPLIIGGIVIPHDRGCEAH 108

Query: 251 SDGDVLLHTVTDAILGALCLPDIGQLFPDTDPKWKGARSDIFLKEAVRLMDEKGYVLGNL 430
           SD         DAILGAL LPDIGQ+FPD+DPKWKGA S +F+KEAVRLMDE GY +GNL
Sbjct: 109 SD--------VDAILGALGLPDIGQIFPDSDPKWKGAASSVFIKEAVRLMDEAGYEIGNL 160

Query: 431 DCTIIAQKPKLSPHKENIRNNLSAILGADPSVVNIKAKTHEK 556
           D T+I Q+PK+SPHKE IR+NLS +LGADPSVVN+KAKTHEK
Sbjct: 161 DATLILQRPKISPHKETIRSNLSKLLGADPSVVNLKAKTHEK 202



EST assemble image


clone accession position
1 LCL038g06_r AV628230 1 220
2 LC026b05_r AV620733 20 507
3 LC077b09_r AV624394 20 533
4 LC083h05_r AV624871 20 492
5 CL30d03_r AV394739 30 556
6 LC093c05_r AV625478 30 450




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research