KCC000447A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000447A_C01 KCC000447A_c01
ccgctgaggacatCCGGAACAAGATGAAGATCAACGACTGGAGCGCTATCCAGGAGCTGT
TCGACACGCTGTGACGCGCGCCTTGACATGGACGCGCAAGTTCCTGTCTGGGCCGATGCT
GCCGCGCGTGTACCTGAAGCTGCTGGTTGACCTGGAGGATTACCTGAATGATACTCTGGC
GAACAAGGAGCTGGTGAAGAAGAAGATGTCGTCCACGAACGCGAAGGCGCTGAACACCAT
GAAGCAGCGCCTGAAGAAGCACAACACGCCCCTGCTGGAGCAGCTCAACAAGGTCCGCGA
GAACCCCGACGAGGAGGACGAGGTGTCGGAGGCGGACAGCAGCAGCAGCGAGAGCGGCAG
CGACGACGAGCGCGACGCCGAGGAGCGCAAGCAGGGCGCCCTGGCCGCCAAGGCCAAGGA
CAAGCTGCTGACCATGGACCCCAAGGAGATCACCTACGAGATGGTGGCGCGCAAGATGAG
GGAGATCGTCATGGCCAGGGGCCGCCGCGGCACCGACAAGCAGGAGGCGGTGGAGATGCT
GACCTACCTGGCCACCGTGGCGCGCGGCGCGGCGCAAAAGTTCGAGGTCCTGGCGCAGCT
GAACGCCAGCCTGTTCGACCTGAACCCGGGCATGCACGGGCACCTGCCCACCGCCACGTG
GCGCAAGGCTGTGGTCAACCTGCTGGAGATGCTGCG


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000447A_C01 KCC000447A_c01
         (696 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|NP_191174.1| PROBABLE EUKARYOTIC TRANSLATION INITIATION FACT...   165  1e-42
pir||T50773 translation initiation factor homolog p105 [imported...   161  2e-41
gb|AAL13083.1| putative translation-initiation factor 3 subunit ...   161  8e-41
dbj|BAC56812.1| putative Eukaryotic translation initiation facto...   157  4e-40
sp|Q9XHM1|IF38_MEDTR Eukaryotic translation initiation factor 3 ...   153  3e-39

>ref|NP_191174.1| PROBABLE EUKARYOTIC TRANSLATION INITIATION FACTOR 3 SUBUNIT 8
           [Arabidopsis thaliana] gi|23503063|sp|O49160|IF38_ARATH
           Eukaryotic translation initiation factor 3 subunit 8
           (eIF3 p110) (eIF3c) (p105) gi|11282364|pir||T47732
           probable translation initiation factor eIF-3 chain 8
           F18O21.110 [imported] - Arabidopsis thaliana
           gi|7572913|emb|CAB87414.1| PROBABLE EUKARYOTIC
           TRANSLATION INITIATION FACTOR 3 SUBUNIT 8 [Arabidopsis
           thaliana] gi|17381100|gb|AAL36362.1| putative eukaryotic
           translation initiation factor 3 subunit 8 [Arabidopsis
           thaliana] gi|25054977|gb|AAN71960.1| putative eukaryotic
           translation initiation factor 3 subunit 8 [Arabidopsis
           thaliana]
          Length = 900

 Score =  165 bits (418), Expect(2) = 1e-42
 Identities = 92/214 (42%), Positives = 135/214 (62%), Gaps = 23/214 (10%)
 Frame = +2

Query: 122 PRVYLKLLVDLEDYLNDTLANKELVKKKMSSTNAKALNTMKQRLKKHNTPLLEQLNKVRE 301
           P +Y+K LV LED+LN+ LANKE  KKKMS++N+KALN+MKQ+LKK+N    + +NK RE
Sbjct: 106 PTLYIKTLVMLEDFLNEALANKE-AKKKMSTSNSKALNSMKQKLKKNNKLYEDDINKYRE 164

Query: 302 NP---------------DEEDEVSEADSSSSES-----GSDDERDAEE---RKQGALAAK 412
            P               D++DEV + D SS +      GSD +   +     K  +   K
Sbjct: 165 APEVEEEKQPEDDDDDDDDDDEVEDDDDSSIDGPTVDPGSDVDEPTDNLTWEKMLSKKDK 224

Query: 413 AKDKLLTMDPKEITYEMVARKMREIVMARGRRGTDKQEAVEMLTYLATVARGAAQKFEVL 592
             +KL+  DPKEIT++ V +K +EIV ARG++GT + E V+ LT+L  +A+  AQK E+L
Sbjct: 225 LLEKLMNKDPKEITWDWVNKKFKEIVAARGKKGTARFELVDQLTHLTKIAKTPAQKLEIL 284

Query: 593 AQLNASLFDLNPGMHGHLPTATWRKAVVNLLEML 694
             + ++ FD+NPG+ GH+P   W+K V+N+L +L
Sbjct: 285 FSVISAQFDVNPGLSGHMPINVWKKCVLNMLTIL 318

 Score = 30.4 bits (67), Expect(2) = 1e-42
 Identities = 11/20 (55%), Positives = 16/20 (80%)
 Frame = +3

Query: 6   EDIRNKMKINDWSAIQELFD 65
           + ++N MKINDW ++QE FD
Sbjct: 68  DQMKNAMKINDWVSLQENFD 87

>pir||T50773 translation initiation factor homolog p105 [imported] - Arabidopsis
           thaliana gi|2789660|gb|AAC83464.1| eIF3c [Arabidopsis
           thaliana]
          Length = 900

 Score =  161 bits (408), Expect(2) = 2e-41
 Identities = 91/214 (42%), Positives = 133/214 (61%), Gaps = 23/214 (10%)
 Frame = +2

Query: 122 PRVYLKLLVDLEDYLNDTLANKELVKKKMSSTNAKALNTMKQRLKKHNTPLLEQLNKVRE 301
           P +Y+K LV LED+LN+ LANKE  KKKMS++N+KALN+MKQ+LKK+N    + +NK RE
Sbjct: 106 PTLYIKTLVMLEDFLNEALANKE-AKKKMSTSNSKALNSMKQKLKKNNKLYEDDINKYRE 164

Query: 302 NP---------------DEEDEVSEADSSSSES-----GSDDERDAEE---RKQGALAAK 412
            P               D++DEV + D SS +      GSD +   +     K  +   K
Sbjct: 165 APEVEEEKQPEDDDDDDDDDDEVEDDDDSSIDGPTVDPGSDVDEPTDNLTWEKMLSKKDK 224

Query: 413 AKDKLLTMDPKEITYEMVARKMREIVMARGRRGTDKQEAVEMLTYLATVARGAAQKFEVL 592
             +KL+  DPKEIT++ V +K +EIV AR ++GT + E V+ LT+L  +A   AQK E+L
Sbjct: 225 LLEKLMNKDPKEITWDWVNKKFKEIVAAREKKGTARFELVDQLTHLTKIANTPAQKLEIL 284

Query: 593 AQLNASLFDLNPGMHGHLPTATWRKAVVNLLEML 694
             + ++ FD+NPG+ GH+P   W+K V+N+L +L
Sbjct: 285 FSVISAQFDVNPGLSGHMPINVWKKCVLNMLTIL 318

 Score = 30.4 bits (67), Expect(2) = 2e-41
 Identities = 11/20 (55%), Positives = 16/20 (80%)
 Frame = +3

Query: 6   EDIRNKMKINDWSAIQELFD 65
           + ++N MKINDW ++QE FD
Sbjct: 68  DQMKNAMKINDWVSLQENFD 87

>gb|AAL13083.1| putative translation-initiation factor 3 subunit [Prunus avium]
          Length = 934

 Score =  161 bits (407), Expect(2) = 8e-41
 Identities = 94/234 (40%), Positives = 134/234 (57%), Gaps = 26/234 (11%)
 Frame = +2

Query: 71  VTRALTWTRKFLSGPMLPRVYLKLLVDLEDYLNDTLANKELVKKKMSSTNAKALNTMKQR 250
           + + L    +      +P +Y+K LV LED+L   LANK+  KKKMSS+NAKALN+MKQ+
Sbjct: 95  INKQLEKVMRITEAVKVPTLYIKALVLLEDFLAQALANKD-AKKKMSSSNAKALNSMKQK 153

Query: 251 LKKHNTPLLEQLNKVRENPDEEDEVSEADSSSSESGS---------------DDERDAEE 385
           LKK+N    E +NK RENP++ DE  EA+  S + GS               DD+ D EE
Sbjct: 154 LKKNNKQYEELINKYRENPEQSDEEKEAEEDSEDDGSVSEIEDPTDIVMSNSDDDGDEEE 213

Query: 386 -----------RKQGALAAKAKDKLLTMDPKEITYEMVARKMREIVMARGRRGTDKQEAV 532
                       K+ +   K  D+    DP EIT++ V +K +E+V ARGR+GT + E V
Sbjct: 214 DEKDDQTDEGWEKKMSKKDKLMDRQFMKDPSEITWDTVNKKFKEVVAARGRKGTGRFEQV 273

Query: 533 EMLTYLATVARGAAQKFEVLAQLNASLFDLNPGMHGHLPTATWRKAVVNLLEML 694
           E LT+L  VA+  AQK EV   + ++ FD+N G++GH+P    +K V N+  +L
Sbjct: 274 EQLTFLTKVAKTPAQKLEVFFSVVSAQFDVNHGLNGHMPINVRKKCVQNMQVIL 327

 Score = 28.5 bits (62), Expect(2) = 8e-41
 Identities = 10/20 (50%), Positives = 15/20 (75%)
 Frame = +3

Query: 12  IRNKMKINDWSAIQELFDTL 71
           ++N M INDW ++QE FD +
Sbjct: 76  MKNAMNINDWVSLQESFDKI 95

>dbj|BAC56812.1| putative Eukaryotic translation initiation factor 3 subunit 8
           [Oryza sativa (japonica cultivar-group)]
          Length = 936

 Score =  157 bits (396), Expect(2) = 4e-40
 Identities = 91/220 (41%), Positives = 132/220 (59%), Gaps = 28/220 (12%)
 Frame = +2

Query: 119 LPRVYLKLLVDLEDYLNDTLANKELVKKKMSSTNAKALNTMKQRLKKHNTPLLEQLNKVR 298
           +P +Y+K LV LED+L + LANKE  KKKMSS+NAKALN MKQ+LKK+N      + + R
Sbjct: 116 VPNMYVKALVLLEDFLAEALANKE-AKKKMSSSNAKALNAMKQKLKKNNKQYENLIQECR 174

Query: 299 ENPDE---------------EDEVSEAD---------SSSSESGSDDERDAEE----RKQ 394
           E+P+                +D+ S+AD         S S E G DDE   ++     K+
Sbjct: 175 EHPERFEDDDVEDKDDDDETDDDASDADIEDPEKMVMSESEEEGDDDEEGDQDGGAWEKK 234

Query: 395 GALAAKAKDKLLTMDPKEITYEMVARKMREIVMARGRRGTDKQEAVEMLTYLATVARGAA 574
            +   K  DK    DP EIT+++V +K++EIV +RG++GT + E VE LT+L  VA+  A
Sbjct: 235 ISKKDKLMDKQFLKDPSEITWDIVDKKLKEIVASRGKKGTGRIERVEQLTFLTRVAKTPA 294

Query: 575 QKFEVLAQLNASLFDLNPGMHGHLPTATWRKAVVNLLEML 694
           QK E+L  + ++ FD+NP + GH+P   W+K V N+L +L
Sbjct: 295 QKLEILFHVISAQFDVNPSLLGHMPVNMWKKCVNNMLLVL 334

 Score = 42.0 bits (97), Expect = 0.009
 Identities = 39/118 (33%), Positives = 46/118 (38%), Gaps = 11/118 (9%)
 Frame = +1

Query: 253  EEAQHAPAGAAQQGPREPRRGGRG-----VGGGQQQQRERQRRRARRRGAQAGR---PGR 408
            E A  A  G   +G    RRGG G     +G  Q+     Q R+   R   +GR   PGR
Sbjct: 821  ERAYEAKTGGTLEGAPPRRRGGDGQDSSNLGKWQENFVSSQGRQGGGRSGYSGRVGGPGR 880

Query: 409  QGQGQAADHGPQGDHLRDGGA---QDEGDRHGQGPPRHRQAGGGGDADLPGHRGARRG 573
             G G   D G QG     GG    QD G    Q     R  GG G A +     + RG
Sbjct: 881  GGGGYQRDRGSQGSRGGYGGGSRFQDGGRSRNQSGSMAR--GGDGGARMVSLNRSGRG 936

 Score = 30.4 bits (67), Expect(2) = 4e-40
 Identities = 12/22 (54%), Positives = 16/22 (72%)
 Frame = +3

Query: 6   EDIRNKMKINDWSAIQELFDTL 71
           + +RN MKINDW  +QE F+ L
Sbjct: 79  DQMRNAMKINDWVNLQESFEKL 100

>sp|Q9XHM1|IF38_MEDTR Eukaryotic translation initiation factor 3 subunit 8 (eIF3 p110)
           (eIF3c) gi|11282366|pir||T50774 probable translation
           initiation factor [imported] - barrel medic
           gi|5106926|gb|AAD39891.1|AF106930_1 putative translation
           initiation protein [Medicago truncatula]
          Length = 935

 Score =  153 bits (387), Expect(2) = 3e-39
 Identities = 90/237 (37%), Positives = 134/237 (55%), Gaps = 29/237 (12%)
 Frame = +2

Query: 71  VTRALTWTRKFLSGPMLPRVYLKLLVDLEDYLNDTLANKELVKKKMSSTNAKALNTMKQR 250
           + + L    + +    +P +Y+K LV LED+L    ANK+  KKKMS +NAKA N+MKQ+
Sbjct: 98  INKQLEKVMRVIESQKIPNLYIKALVMLEDFLAQASANKD-AKKKMSPSNAKAFNSMKQK 156

Query: 251 LKKHNTPLLEQLNKVRENPDEEDEVSEADSSSSESGSDDER-------------DAEERK 391
           LKK+N    + + K RE+P+ E E  E D  S E  SDDE              D+E  +
Sbjct: 157 LKKNNKQYEDLIIKCRESPESEGEKDEDDEDSDEYESDDEMIEPDQLRKPEPVSDSETSE 216

Query: 392 QG--------------ALAAKAK--DKLLTMDPKEITYEMVARKMREIVMARGRRGTDKQ 523
            G               L+ K +  +K+    P EIT++ V +K +EI+ ARGR+GT + 
Sbjct: 217 LGNDRPGDDGDAPWDQKLSKKDRLLEKMFMKKPSEITWDTVNKKFKEILEARGRKGTGRF 276

Query: 524 EAVEMLTYLATVARGAAQKFEVLAQLNASLFDLNPGMHGHLPTATWRKAVVNLLEML 694
           E VE LT+L  VA+  AQK ++L  + ++ FD+NPG+ GH+P + W+K V N+L +L
Sbjct: 277 EQVEQLTFLTKVAKTPAQKLQILFSVVSAQFDVNPGLSGHMPISVWKKCVQNMLVIL 333

 Score = 30.8 bits (68), Expect(2) = 3e-39
 Identities = 11/22 (50%), Positives = 17/22 (77%)
 Frame = +3

Query: 6   EDIRNKMKINDWSAIQELFDTL 71
           + I+N +KINDW ++QE FD +
Sbjct: 77  DQIKNAIKINDWVSLQESFDKI 98



EST assemble image


clone accession position
1 LCL027c07_r AV627474 1 327
2 CL30c08_r AV394754 14 396
3 LCL001h01_r AV626061 196 628
4 HCL098g09_r AV645146 202 696




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research