KCC000446A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000446A_C01 KCC000446A_c01
tcagattacgtacactaccaagccgcacacagcCACGGTCCAGACGTCTCTAAGCAAAGC
CATCACGTCAGCAATGGACACCGACAGTCGGCCCGGCACCAGCGATAACGCCGAGGCCGG
CGCGCATGATTGGTCCCGACTGACGCCCGATGTCATTCGCAACATTGCTAGCTGGCTGCA
CCCAACCCAAGTCGCGATTGGTCTCCTGCTCGTCGACCGGGCCACAGCTGCATGCCTCAA
GGGTAGCTATAATGTCATTACAATATACACTTGCAAGCCAAGCCGTTTTTTGCGTCCCCG
GCTGGAGGTCGCGCACGCGAGCTCATGGCCCGGACACAGCTTCGCGCATTACTGGGGCCG
GCCCAAGCCGTGGGATAAGCTTACACTCCGCCGCCGGCTGCGCCTGCTGTGCCTTGCCGC
CTCTAGCTTCCATCCCGCCAGCCTGCACGTAGCTCTGCAGTTCAGCGGCGTTGCGCTGCG
GCCGGAGGTTGCGGAGGCTGCCTCGGCGGCCGGCGACTTGCAGGCGGTCCAGCGCCTGGT
CGCCGAGGGCTGCGAGCTCAGCTTGGAAGCAGTGAAGCTGGCTGCGGCTTGCGGCCACTT
GAGTGTGCTGCAATGGATCTGGTCGGGAGCTGAGCCGCAGCTGCGGCTCCGCAGCGCATT
TGGCTGGGAGGCCGCGGGTTCGCACCAAGCCGTGGCGGAGGCGGCGTGCGCCGGC


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000446A_C01 KCC000446A_c01
         (715 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|XP_323120.1| hypothetical protein [Neurospora crassa] gi|115...    47  4e-04
ref|NP_044469.1| RL2 [Human herpesvirus 2] gi|124135|sp|P28284|I...    47  4e-04
ref|ZP_00092697.1| COG1020: Non-ribosomal peptide synthetase mod...    47  4e-04
ref|NP_044528.1| RL2 [Human herpesvirus 2] gi|1869881|emb|CAB067...    47  4e-04
ref|XP_324404.1| predicted protein [Neurospora crassa] gi|289174...    46  7e-04

>ref|XP_323120.1| hypothetical protein [Neurospora crassa] gi|11595639|emb|CAC18259.1|
            conserved hypothetical protein [Neurospora crassa]
            gi|28922749|gb|EAA31972.1| hypothetical protein
            [Neurospora crassa]
          Length = 2084

 Score = 46.6 bits (109), Expect = 4e-04
 Identities = 44/151 (29%), Positives = 67/151 (44%), Gaps = 9/151 (5%)
 Frame = -3

Query: 713  RRTPPPPRLG------ANPRPPSQMRCGAAAAAQLPTRSIAAHSSGRKPQPASLLPS*AR 552
            + TPPPP+ G      ++P PP  M  G  +A   P R+ A  +    P+PA+L+PS   
Sbjct: 1935 KSTPPPPKGGIPRSSASSPAPPMGMGVGGGSAPNTPGRASAPPTG--PPRPAALMPS--A 1990

Query: 551  SPRRPGAGPPASRRP--PRQPPQPPAAAQRR*TAELRAGWRDGS*RRQGTAGAAGGGV*A 378
            S    G+GPP++  P  P     PP+A        L  G    + +R  +   +G     
Sbjct: 1991 SESNVGSGPPSAVGPLSPSGSNGPPSAGL------LSPGMGPAAMQRPASTSTSGP---- 2040

Query: 377  YPTAWAGPSNARSCVRAMSSRARP-PAGDAK 288
             P   + P +A S +  +   A P   G+AK
Sbjct: 2041 -PAGTSKPLSATSSIDDLLGAAVPRKRGEAK 2070

>ref|NP_044469.1| RL2 [Human herpesvirus 2] gi|124135|sp|P28284|ICP0_HSV2H
           Trans-acting transcriptional protein ICP0 (VMW118
           protein) gi|73650|pir||EDBEXD immediate-early protein
           RL2 - human herpesvirus 2 (strain HG52)
           gi|1869822|emb|CAB06760.1| RL2 [Human herpesvirus 2]
           gi|2626942|dbj|BAA23427.1| Vmw118(ICP0) [Human
           herpesvirus 2]
          Length = 825

 Score = 46.6 bits (109), Expect = 4e-04
 Identities = 38/124 (30%), Positives = 47/124 (37%), Gaps = 3/124 (2%)
 Frame = -3

Query: 704 PPPPRLGANPRPPSQMRCGAAAAAQLPTRSIAAHSSGRKPQPASLLPS*ARSPRRPGAGP 525
           PP PR  A P P S +   +A  +  P       SSGR  +P + +    RSP R  A P
Sbjct: 370 PPSPRRPAGPGPLSFVSSSSAQVSSGPGGGGLPQSSGRAARPRAAVAPRVRSPPRAAAAP 429

Query: 524 PASRRPPRQPPQPPAA---AQRR*TAELRAGWRDGS*RRQGTAGAAGGGV*AYPTAWAGP 354
             S       P PPA    A R   + +     D   +  G AGA        P A  GP
Sbjct: 430 VVSASADAAGPAPPAVPVDAHRAPRSRMTQAQTDTQAQSLGRAGATDARGSGGPGAEGGP 489

Query: 353 SNAR 342
              R
Sbjct: 490 GVPR 493

>ref|ZP_00092697.1| COG1020: Non-ribosomal peptide synthetase modules and related
            proteins [Azotobacter vinelandii]
          Length = 4332

 Score = 46.6 bits (109), Expect = 4e-04
 Identities = 47/139 (33%), Positives = 54/139 (38%)
 Frame = -3

Query: 698  PPRLGANPRPPSQMRCGAAAAAQLPTRSIAAHSSGRKPQPASLLPS*ARSPRRPGAGPPA 519
            P R G NPR P      A AA   P R   A   GR+      LP   R  RR G G   
Sbjct: 1533 PHRTGGNPRAP------AVAAGGAPGRGAGAR--GRRGCATGRLPDQRRRTRRSGPGRTP 1584

Query: 518  SRRPPRQPPQPPAAAQRR*TAELRAGWRDGS*RRQGTAGAAGGGV*AYPTAWAGPSNARS 339
              RP RQP     A   R      A     + R+ G+ GAAG G+       AG    RS
Sbjct: 1585 QARPGRQPAGVHGAGAVRPPRRAAA----DADRQAGSQGAAGAGL-------AGGRIRRS 1633

Query: 338  CVRAMSSRARPPAGDAKNG 282
              RA ++    P GD   G
Sbjct: 1634 ARRARTA----PGGDLAGG 1648

 Score = 41.2 bits (95), Expect = 0.016
 Identities = 39/102 (38%), Positives = 44/102 (42%), Gaps = 15/102 (14%)
 Frame = -3

Query: 647  AAAAAQLPTRSIAAHSSGRKPQPASLLPS*ARSPRRPGAGPPASRRP------------- 507
            A A A+L  R   A  +GR+P         AR   RPG G  A  RP             
Sbjct: 1115 APATARLGAR---AGRTGRRPA--------ARIADRPGTGDAAGHRPGQWRGDPRLHRPG 1163

Query: 506  -PRQPP-QPPAAAQRR*TAELRAGWRDGS*RRQGTAGAAGGG 387
             PRQPP  PPA A RR   E R   R    RR+   G+AGGG
Sbjct: 1164 APRQPPGAPPARAGRRPGGEGRPAGRT---RRRTDGGSAGGG 1202

>ref|NP_044528.1| RL2 [Human herpesvirus 2] gi|1869881|emb|CAB06705.1| RL2 [Human
           herpesvirus 2]
          Length = 826

 Score = 46.6 bits (109), Expect = 4e-04
 Identities = 38/124 (30%), Positives = 47/124 (37%), Gaps = 3/124 (2%)
 Frame = -3

Query: 704 PPPPRLGANPRPPSQMRCGAAAAAQLPTRSIAAHSSGRKPQPASLLPS*ARSPRRPGAGP 525
           PP PR  A P P S +   +A  +  P       SSGR  +P + +    RSP R  A P
Sbjct: 371 PPSPRRPAGPGPLSFVSSSSAQVSSGPGGGGLPQSSGRAARPRAAVAPRVRSPPRAAAAP 430

Query: 524 PASRRPPRQPPQPPAA---AQRR*TAELRAGWRDGS*RRQGTAGAAGGGV*AYPTAWAGP 354
             S       P PPA    A R   + +     D   +  G AGA        P A  GP
Sbjct: 431 VVSASADAAGPAPPAVPVDAHRAPRSRMTQAQTDTQAQSLGRAGATDARGSGGPGAEGGP 490

Query: 353 SNAR 342
              R
Sbjct: 491 GVPR 494

>ref|XP_324404.1| predicted protein [Neurospora crassa] gi|28917485|gb|EAA27185.1|
            predicted protein [Neurospora crassa]
          Length = 2992

 Score = 45.8 bits (107), Expect = 7e-04
 Identities = 32/83 (38%), Positives = 39/83 (46%), Gaps = 7/83 (8%)
 Frame = -3

Query: 692  RLGANPRPPSQMRCGAAAAAQLPTRSIAAHSSGRKP---QPASLLPS*ARS----PRRPG 534
            R    PR P+Q    AA  A+   RS A  S   +P   +PA  +PS  RS    PR  G
Sbjct: 2636 RPAPQPRVPAQQPSRAADPAKQAPRSAAPASQAARPASTRPAGTVPSQPRSSGGQPRPSG 2695

Query: 533  AGPPASRRPPRQPPQPPAAAQRR 465
            + P  S   PR PP PPA   R+
Sbjct: 2696 SQPRPSGSQPRPPPPPPAPLPRQ 2718



EST assemble image


clone accession position
1 LCL099b12_r AV631752 1 479
2 CL30b05_r AV394749 34 562
3 HCL002c02_r AV639637 270 715




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research