KCC000444A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000444A_C01 KCC000444A_c01
CACGTGCTTAGCGTAGCCGGATAGAACGGGGAGCTTGCCGTGGGAGGCAATGGATCTGAC
ACTTTCAGGACTATGTGGAGGTGTTTTGTGCTCGGCTGACTAGGTTACGGACAATGTCAT
TTGACTCTACAGAGGTGTTTCAGGTGCCATAGACACGGAGAACGGGCATGGTCTGCTGGC
GCGGATGCACCTGTTGAGAAACCGCAGTGCTTTTGTCGTGGCTGAGCGAACTACTCGTGT
GTGCAAGATACGGTATGCTGCATTCAGATCATGGCTGCGTCTATACCGTTGCATTTATCT
GCTGCGAAGGCGATGGGATGGGGATGGCCATGACACCCAGTATAGGGTTGGTGCCATGGG
TTGGTGCTCACTGCTCAACACCAACGCCGCCTGGTTGTGCCGCGCAGCTTGGACAGCCGC
CATATGGTCACAGGTGTGGCGTCTTGGTGTTTGTATGGCGCCCTATGGTGCTGGCCGGAG
CGGACTGCATCTCAAGCTGCGCGTCAGCGAAACATGGCGTGACCAnGGCGGCGCGTCCAT
TACCGTAAACCCGTCGCGTTCCCAGTTTACTGCACTAATCCTC


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000444A_C01 KCC000444A_c01
         (583 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|XP_286157.1| similar to ribosomal protein L7a, cytosolic [va...    35  0.58
ref|NP_044250.1| TrbL [Enterobacter aerogenes] gi|7465749|pir||T...    35  1.00
ref|NP_857987.1| putative DNA topoisomerase [Uncultured bacteriu...    35  1.00
gb|AAK38012.1| mating pair formation protein TrbL [Comamonas tes...    35  1.00
ref|XP_213271.2| similar to 3230401M21Rik protein [Rattus norveg...    33  2.2

>ref|XP_286157.1| similar to ribosomal protein L7a, cytosolic [validated] - rat [Mus
           musculus]
          Length = 260

 Score = 35.4 bits (80), Expect = 0.58
 Identities = 33/113 (29%), Positives = 43/113 (37%), Gaps = 1/113 (0%)
 Frame = +1

Query: 130 QRCFRCHRHGERAWSAGADAPVEKPQCFCRG*ANYSCVQDTVCCIQIMAASIPLHLSAAK 309
           Q   RC R G R    G + P            + SC+Q T C IQ+  AS P    A +
Sbjct: 21  QETSRCMRWGSR----GVEGP------------SGSCIQGTGCSIQVQPASAPGLRIATE 64

Query: 310 AMGWG-WP*HPV*GWCHGLVLTAQHQRRLVVPRSLDSRHMVTGVASWCLYGAL 465
             G    P H    W   L     H+R+L +P+  +   M  G  S    G L
Sbjct: 65  LEGQSQCPPHSGASWASLLATAGCHRRKLRIPQFTEPLLMHLGTISSYYRGPL 117

>ref|NP_044250.1| TrbL [Enterobacter aerogenes] gi|7465749|pir||T08509 trbL protein -
           Enterobacter aerogenes plasmid R751
           gi|1572558|gb|AAC64453.1| TrbL [Enterobacter aerogenes]
          Length = 572

 Score = 34.7 bits (78), Expect = 1.00
 Identities = 14/38 (36%), Positives = 20/38 (51%)
 Frame = +2

Query: 338 QYRVGAMGWCSLLNTNAAWLCRAAWTAAIWSQVWRLGV 451
           +Y+  A GW  ++ T A WL    WT  + S VW  G+
Sbjct: 41  RYQTAASGWAGVITTAATWL---FWTLVVISMVWTFGM 75

>ref|NP_857987.1| putative DNA topoisomerase [Uncultured bacterium]
           gi|32455862|ref|NP_862515.1| TrbL protein [Pseudomonas
           sp. ADP] gi|34500501|ref|NP_904272.1| TrbL [Delftia
           acidovorans] gi|13937498|gb|AAK50309.1|U66917_78 TrbL
           protein [Pseudomonas sp. ADP]
           gi|31746373|emb|CAD97498.1| putative DNA topoisomerase
           [uncultured bacterium] gi|34013322|dbj|BAC81995.1| TrbL
           [Delftia acidovorans]
          Length = 572

 Score = 34.7 bits (78), Expect = 1.00
 Identities = 14/38 (36%), Positives = 20/38 (51%)
 Frame = +2

Query: 338 QYRVGAMGWCSLLNTNAAWLCRAAWTAAIWSQVWRLGV 451
           +Y+  A GW  ++ T A WL    WT  + S VW  G+
Sbjct: 41  RYQAAASGWAGVITTAATWL---FWTLVVISMVWTFGM 75

>gb|AAK38012.1| mating pair formation protein TrbL [Comamonas testosteroni]
          Length = 572

 Score = 34.7 bits (78), Expect = 1.00
 Identities = 14/38 (36%), Positives = 20/38 (51%)
 Frame = +2

Query: 338 QYRVGAMGWCSLLNTNAAWLCRAAWTAAIWSQVWRLGV 451
           +Y+  A GW  ++ T A WL    WT  + S VW  G+
Sbjct: 41  RYQAAASGWAGVITTAATWL---FWTLVVISMVWTFGM 75

>ref|XP_213271.2| similar to 3230401M21Rik protein [Rattus norvegicus]
          Length = 1565

 Score = 33.5 bits (75), Expect = 2.2
 Identities = 32/104 (30%), Positives = 39/104 (36%), Gaps = 1/104 (0%)
 Frame = -3

Query: 374  AVSTNPWHQPYTGCHGHP-HPIAFAADKCNGIDAAMI*MQHTVSCTHE*FAQPRQKHCGF 198
            A  +N    P    H  P H +AF  D+   I A        V  T E   +    H  +
Sbjct: 821  AAGSNGLQLPVYIGHSEPVHAVAFTPDQLQLISAGDAIFLWDVQATPE---RQALMHDIW 877

Query: 197  STGASAPADHARSPCLWHLKHLCRVK*HCP*PSQPSTKHLHIVL 66
             T    P D   S CL+HL+H      HCP    P T  L  VL
Sbjct: 878  RTWHPGPVDSLGSKCLYHLRH------HCP-HGVPMTDSLKAVL 914



EST assemble image


clone accession position
1 LC063f12_r AV623434 1 470
2 CL30a10_r AV394774 56 583




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research