KCC000443A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000443A_C01 KCC000443A_c01
ctccgtggtgcgcatcctctcctccgccggcaccctcaccctggacgacaccaccgtgca
cttctcctccgacgtcgcgcCCATCTTCTCAGAGGCTGGCTTCGCTGTCACCTCCAACGC
CGGCTCGCGCCGCCGCCTGCTGGCGGGCCAGTACACGCTGTACGGCTACTTCAGCTCCAT
CCAGAACATCACCTCCTTCGACCCGGTGGACGTGTCTAAACCCAAGCTGCCCAGCAAGGA
CTTCTCCATGCAGCTGGCCGTGCTGGAGCCCTGCGTGCTGCCCAGTGCCCCCACCGTGGA
CCGCTGTCTGTACGACCCCACCGGCGCCGCCGCCTCCGGAGCCGCGCACCACCGCCGCCG
CGATCTGCTGGCCACCGCCGCCGGATCCAGCGTGCAGCCCGTGGACATCCCCGGCACCAC
CATCGACGCTAAGACTGGCGAGCGCTACATGGTCCACCGCCGCCGCATCACCTACCTGGG
CAAGCTGATTCGCTCCGTGTCGTCGTACGACTCCGCCCCCGGCCTGCAGCGCGTGTCGCT
CATGGACACCGGCTCCGGCGCCGTTTCGGAGTGGCAGGAGAAGGCACACCCTGAGGACAC
CGACCTGGACGCCGCTGATGTGCGCGGCTACTGCAACTCCTACACGCTGCCGGGCGAGCA
CCTGGAACAGCTGTCGCTGCTGCGCGACCTGTCGGCCGCCGACTTCAAGTACCTGGGCGA
TGAGCAGAAGATGGGCAAGGCTGCCCGCCACTTCACCTTCAACGCCAAGCAGCCCGCGGC
GCTGTCGGGCGTCAAGAGCGCCGACACCATCAGCATTGAGTACTGGGACACCATCGACGG
CTTCAAGCCCATCGTCTTCGAGCTGAACCACCCCACGCTGGGCAAGCTGCGCTACGTGGT
CGAGGACCTTAAGCTGGCTCTCACCGCCAGCTCGTTGGCCGCCTCAGCCTTCATCGCGCC
CACGCCCGCCAGCTGCTCCGTGGGCTGCATGCCGCGCCTGGGCTCGGCCTTCAGCGTGCC
TGTGCCCTCGCAGCGCTGGTCCGAGCTGGGCGCCGGCAACCGCCGCAACCTGCTGTCCGC
CGAGTCCGCTAAGCACTTTCACGCCCAGCAGCACTCCG


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000443A_C01 KCC000443A_c01
         (1118 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

pir||A43932 mucin 2 precursor, intestinal - human (fragments)         112  9e-24
gb|AAA59163.1| mucin                                                  112  9e-24
ref|NP_002448.1| mucin 2 [Homo sapiens] gi|2506877|sp|Q02817|MUC...   112  9e-24
gb|AAA59875.1| mucin                                                  112  9e-24
ref|NP_767161.1| blr0521 [Bradyrhizobium japonicum] gi|27348769|...   103  4e-21

>pir||A43932 mucin 2 precursor, intestinal - human (fragments)
          Length = 3020

 Score =  112 bits (281), Expect = 9e-24
 Identities = 115/398 (28%), Positives = 152/398 (37%), Gaps = 28/398 (7%)
 Frame = +3

Query: 9    CASSPPP---APSPWTTPPCTSPPTSRPSSQRLASLSPPTPARAAACWRASTRCTATSAP 179
            C ++P P    PSP  T   T PPT+ PS     + +PP     +     +T    T+ P
Sbjct: 1395 CITTPSPPTTTPSPPPTTTTTLPPTTTPSPPTTTTTTPPPTTTPSPPITTTTTPLPTTTP 1454

Query: 180  S-----RTSPPSTRWTCLNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAPP---- 332
            S      T+PP T  T  +P     + P + P         PPP     TT P+PP    
Sbjct: 1455 SPPISTTTTPPPT--TTPSPPTTTPSPPTTTPSPPTTTTTTPPP-----TTTPSPPMTTP 1507

Query: 333  --PPEPRTTAAAICWPPPPDPACS---PWTSPAPPSTLRLASATWSTAAASPTWAS*FAP 497
              PP   TT      P PP    +   P T+P+PP+T  +   T ST    PT      P
Sbjct: 1508 ITPPASTTTLPPTTTPSPPTTTTTTPPPTTTPSPPTTTPITPPT-STTTLPPTTTPSPPP 1566

Query: 498  CRRTTPPPACSACRSWTPAPAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCR 677
               TTPPP  +     T  P+P        T  TP  T      T T T    +T  S  
Sbjct: 1567 TTTTTPPPTTTPSPPTTTTPSP-----PTITTTTPPPTTTPSPPTTTTTTPPPTTTPSPP 1621

Query: 678  CCATCRPPTSSTWAMSRRWARLPATSPST--PSSPRRCRASRAPTPSALSTGTPSTASSP 851
                  PPTS+T          P T+ +T  P++      +  P+P   +T TP   ++P
Sbjct: 1622 TTTPITPPTSTTTLPPTTTPSPPPTTTTTPPPTTTPSPPTTTTPSPPITTTTTPPPTTTP 1681

Query: 852  SSSS*TTPR--WASCATWSRTLSWLSP-PARWPPQPSSRPRPPAAPWAACRAWARPSACL 1022
            SS   TTP     +  T S T +  SP      P  ++ P PP            P+   
Sbjct: 1682 SSPITTTPSPPTTTMTTPSPTTTPSSPITTTTTPSSTTTPSPP------------PTTMT 1729

Query: 1023 CPRSAGPSWAPATAATCCPP----SPLST--FTPSSTP 1118
             P        P T  T  PP    SPL+T    PS TP
Sbjct: 1730 TPSPTTTPSPPTTTMTTLPPTTTSSPLTTTPLPPSITP 1767

 Score =  104 bits (259), Expect = 3e-21
 Identities = 118/406 (29%), Positives = 161/406 (39%), Gaps = 47/406 (11%)
 Frame = +3

Query: 15   SSPPPA--PSPWTTPPCTSPPTSRPSSQRLASLSPP---TPARAAACWRASTRCTATSAP 179
            ++PPP   PSP TT P  SPPT+ PS     + +PP   TP+            T T  P
Sbjct: 1462 TTPPPTTTPSPPTTTP--SPPTTTPSPPTTTTTTPPPTTTPSPPMTTPITPPASTTTLPP 1519

Query: 180  SRT-SPPSTRWTCLNPSC---PARTSPCSWPCWS----PACCPVPPPWTAVCTTPPAPP- 332
            + T SPP+T  T   P+    P  T+P + P  +    P   P PPP T   TTPP  P 
Sbjct: 1520 TTTPSPPTTTTTTPPPTTTPSPPTTTPITPPTSTTTLPPTTTPSPPPTTT--TTPP--PT 1575

Query: 333  -PPEPRTTAA------AICWPPP---PDPACS------PWTSPAPPSTLRLASATWSTAA 464
              P P TT            PPP   P P  +      P T+P+PP+T  +   T ST  
Sbjct: 1576 TTPSPPTTTTPSPPTITTTTPPPTTTPSPPTTTTTTPPPTTTPSPPTTTPITPPT-STTT 1634

Query: 465  ASPTWAS*FAPCRRTTPPPACSACRSWTPAPAPFRSGRRRHTLRTPTWTPLMCAATATPT 644
              PT      P   TTPPP  +     T  P+P                P+    T  PT
Sbjct: 1635 LPPTTTPSPPPTTTTTPPPTTTPSPPTTTTPSP----------------PITTTTTPPPT 1678

Query: 645  RCRASTWNSCRCCATCRPPTSSTWAMSRRWARLPATSPSTPSSPRRCRASR---APTPSA 815
                 T  S     T  PPT++    S      P T+PS+P +     +S    +P P+ 
Sbjct: 1679 -----TTPSSPITTTPSPPTTTMTTPS------PTTTPSSPITTTTTPSSTTTPSPPPTT 1727

Query: 816  LSTGTPSTASSPSSSS*TT--PRWASCATWSRTLSWLSPPARWPPQPSSRPRPPAAPWAA 989
            ++T +P+T  SP +++ TT  P   S    +  L     P  + P  ++ P  P  P   
Sbjct: 1728 MTTPSPTTTPSPPTTTMTTLPPTTTSSPLTTTPLPPSITPPTFSPFSTTTPTTPCVPLCN 1787

Query: 990  CRAW---ARPS-------ACLCPRSAGPSWAP--ATAATCCPPSPL 1091
               W    +P+         L     GP WA   +  AT  P  P+
Sbjct: 1788 WTGWLDSGKPNFHKPGGDTELIGDVCGPGWAANISCRATMYPDVPI 1833

 Score = 90.5 bits (223), Expect = 5e-17
 Identities = 97/343 (28%), Positives = 128/343 (37%), Gaps = 15/343 (4%)
 Frame = +3

Query: 126  RAAACWRASTRCTATSAPSRT-SPPSTRWTCL----NPSCPARTSPCSWPCWSPACCPVP 290
            R   CW      T  S P+ T SPP T  T L     PS P  T+    P  +P+  P+ 
Sbjct: 1385 RVNCCWPMDKCITTPSPPTTTPSPPPTTTTTLPPTTTPSPPTTTTTTPPPTTTPSP-PIT 1443

Query: 291  PPWTAVCTTPPAPP-----PPEPRTTAAAICWPPPPDPACSPWTSPAPPSTLRLASATWS 455
               T + TT P+PP      P P TT +     PP      P T+P+PP+T         
Sbjct: 1444 TTTTPLPTTTPSPPISTTTTPPPTTTPS-----PPTTTPSPPTTTPSPPTT--------- 1489

Query: 456  TAAASPTWAS*FAPCRRTTPPPACSACRSWTPAPAPFRSGRRRHTLRTPTWTPLMCAATA 635
            T    P   +   P      PPA +     T  P+P  +     T  TP  T      T 
Sbjct: 1490 TTTTPPPTTTPSPPMTTPITPPASTTTLPPTTTPSPPTT-----TTTTPPPTTTPSPPTT 1544

Query: 636  TPTRCRASTWNSCRCCATCRPPTSSTWAMSRRWARLPATSPSTPSSPRRCRASRAPTPSA 815
            TP     ST           PPT++T          P T+PS P+       +  P+P  
Sbjct: 1545 TPITPPTSTTTLPPTTTPSPPPTTTT-------TPPPTTTPSPPT-------TTTPSPPT 1590

Query: 816  LSTGT--PSTASSPSSSS*TTPRWASCATWSRTLSWLSPPARWPPQPSSRPRPPAAPWAA 989
            ++T T  P+T  SP +++ TTP                PP   P  P++ P  P      
Sbjct: 1591 ITTTTPPPTTTPSPPTTTTTTP----------------PPTTTPSPPTTTPITPPT---- 1630

Query: 990  CRAWARPSACLCPRSAGPSWAPATAATCCP---PSPLSTFTPS 1109
                   S    P +  PS  P T  T  P   PSP +T TPS
Sbjct: 1631 -------STTTLPPTTTPSPPPTTTTTPPPTTTPSPPTTTTPS 1666

 Score = 78.2 bits (191), Expect = 2e-13
 Identities = 104/430 (24%), Positives = 146/430 (33%), Gaps = 58/430 (13%)
 Frame = +3

Query: 3    PWCASSPPPAPSPWTTPPCT--SPPTSRPSSQRLASLSPPTPARAAACWRASTRCTATSA 176
            P    SPPP  +  T PP T  SPPT+   S  + + + P P             T  S+
Sbjct: 1637 PTTTPSPPPTTT-TTPPPTTTPSPPTTTTPSPPITTTTTPPPT------------TTPSS 1683

Query: 177  PSRT--SPPSTRWTCLNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAPPPPEPRT 350
            P  T  SPP+T  T  +P+    +   +    S    P PPP T    +P   P P P T
Sbjct: 1684 PITTTPSPPTTTMTTPSPTTTPSSPITTTTTPSSTTTPSPPPTTMTTPSPTTTPSP-PTT 1742

Query: 351  TAAAICWPPPPDPACSP-WTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPAC 527
            T   +    PP    SP  T+P PPS               PT    F+P   TTP   C
Sbjct: 1743 TMTTL----PPTTTSSPLTTTPLPPS------------ITPPT----FSPFSTTTPTTPC 1782

Query: 528  SACRSWT-----PAPAPFRSGRRRHTLRT---PTWTP-LMCAATATP----------TRC 650
                +WT       P   + G     +     P W   + C AT  P            C
Sbjct: 1783 VPLCNWTGWLDSGKPNFHKPGGDTELIGDVCGPGWAANISCRATMYPDVPIGQLGQTVVC 1842

Query: 651  RASTWNSCR-----------------------CCATCRPPTSSTWAMSRRWARLPATSPS 761
              S    C+                       CC     PT+ T   +      P T+ +
Sbjct: 1843 DVSVGLICKNEDQKPGGVIPMAFCLNYEINVQCCECVTQPTTMTTTTTENPTPTPITTTT 1902

Query: 762  ------TPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*TTPRWASCATWSRTLSWLS 923
                  TP+S +     +APTP+ +ST T +   +P+ +   TP      T +      +
Sbjct: 1903 TVTPTPTPTSTQSPNGLQAPTPTPIST-TTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 1961

Query: 924  PPARWPP-----QPSSRPRPPAAPWAACRAWARPSACLCPRSAGPSWAPATAATCCPPSP 1088
            P     P       ++   P   P +       P       +A P+       T  P S 
Sbjct: 1962 PTGTQTPTTVLITTTTTMTPTPTPTSTKSTTVTPITTTTTVTATPTPTGTQTPTMIPIST 2021

Query: 1089 LSTFTPSSTP 1118
             +T TP+ TP
Sbjct: 2022 TTTVTPTPTP 2031

 Score = 68.2 bits (165), Expect = 3e-10
 Identities = 75/295 (25%), Positives = 110/295 (36%), Gaps = 12/295 (4%)
 Frame = +3

Query: 27   PAPSPWTTPPCTSPPTSRPSSQRLASLSPPTPARAAACWRASTRCTATSAPSRTSPPSTR 206
            P P+P TT    +P  +  S+Q    L  PTP   +     +T  T T  P+ T  P+T 
Sbjct: 1893 PTPTPITTTTTVTPTPTPTSTQSPNGLQAPTPTPIS----TTTTVTPTPTPTGTQTPTT- 1947

Query: 207  WTCLNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAPPPP---------EPRTTAA 359
                    P  T+    P  +P     P       TT   P P           P TT  
Sbjct: 1948 -------TPITTTTTVTPTPTPTGTQTPTTVLITTTTTMTPTPTPTSTKSTTVTPITTTT 2000

Query: 360  AICWPPPPDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTT---PPPACS 530
             +   P P    +P   P   +T    + T +T +  P   +  AP    T   PPP  S
Sbjct: 2001 TVTATPTPTGTQTPTMIPISTTTTVTPTPTPTTGSTGPPTHTSTAPIAELTTSNPPPESS 2060

Query: 531  ACRSWTPAPAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSS 710
              ++     +P        TL +     +   +TA P+   A T  S     T  PP S+
Sbjct: 2061 TPQTSRSTSSPLTEST---TLLSTLPPAIEMTSTAPPSTPTAPTTTSGG--HTLSPPPST 2115

Query: 711  TWAMSRRWARLPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*TTP 875
            T            + P TP+      +S APTPS + T T ++A +P+ +  +TP
Sbjct: 2116 T-----------TSPPGTPTRGTTTGSSSAPTPSTVQT-TTTSAWTPTPTPLSTP 2158

 Score = 62.4 bits (150), Expect = 1e-08
 Identities = 80/296 (27%), Positives = 109/296 (36%), Gaps = 15/296 (5%)
 Frame = +3

Query: 276  CCPVPPPWTAVCTTPPAPPPPEPRTTAAAICWPPPPDPACSPWTSPAPPSTLRLASATWS 455
            CC      T + TT    P P P TT   +   P P    SP    AP  T     +T +
Sbjct: 1875 CCECVTQPTTMTTTTTENPTPTPITTTTTVTPTPTPTSTQSPNGLQAPTPT---PISTTT 1931

Query: 456  TAAASPTWAS*FAPCRRTTPPPACSACRSWTPAPAPFRSGRRRHTLRTPTWTPLMCAATA 635
            T   +PT      P   TT P   +   + TP P   ++        T T TP     T 
Sbjct: 1932 TVTPTPTPTGTQTP---TTTPITTTTTVTPTPTPTGTQTPTTVLITTTTTMTP-----TP 1983

Query: 636  TPTRCRAST----WNSCRCCATCRPPTSSTWAM---SRRWARLPATSPSTPSSPRRCRAS 794
            TPT  +++T      +    AT  P  + T  M   S      P  +P+T S+      S
Sbjct: 1984 TPTSTKSTTVTPITTTTTVTATPTPTGTQTPTMIPISTTTTVTPTPTPTTGSTGPPTHTS 2043

Query: 795  RAPTPSALSTGTPSTASSPSSSS*TTPRWASCATWSRTLSWLSPPA--RWPPQPSSRPRP 968
             AP     ++  P  +S+P +S  T    +S  T S TL    PPA       P S P  
Sbjct: 2044 TAPIAELTTSNPPPESSTPQTSRST----SSPLTESTTLLSTLPPAIEMTSTAPPSTPTA 2099

Query: 969  PAAPWAACRAWARPSACLCPRSAGPSWAPATAATCCP-PSPLST-----FTPSSTP 1118
            P            PS    P    P+    T ++  P PS + T     +TP+ TP
Sbjct: 2100 PTTTSGGHTLSPPPSTTTSPPGT-PTRGTTTGSSSAPTPSTVQTTTTSAWTPTPTP 2154

 Score = 53.5 bits (127), Expect = 6e-06
 Identities = 78/313 (24%), Positives = 106/313 (32%), Gaps = 32/313 (10%)
 Frame = +3

Query: 15   SSPPPAPSPWTTPPCTSPPTSRPSSQRLASLSPPTPARAAACWRASTRCTATSAPSRTSP 194
            ++ P   +   TP  T   T  P++  + + +  TP       +++T    T+  + T+ 
Sbjct: 1946 TTTPITTTTTVTPTPTPTGTQTPTTVLITTTTTMTPTPTPTSTKSTTVTPITTTTTVTAT 2005

Query: 195  PSTRWTCLNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAP-----PPPEPRTTAA 359
            P+   T      P  T+    P  +P      PP T   T P A      PPPE  T   
Sbjct: 2006 PTPTGTQTPTMIPISTTTTVTPTPTPTTGSTGPP-THTSTAPIAELTTSNPPPESSTPQT 2064

Query: 360  AICWPPPPD---------PACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTT 512
            +     P           P     TS APPST    + T      SP       P   T+
Sbjct: 2065 SRSTSSPLTESTTLLSTLPPAIEMTSTAPPSTPTAPTTTSGGHTLSP------PPSTTTS 2118

Query: 513  PP--PACSACRSWTPAPAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCA 686
            PP  P        + AP P        +  TPT TPL   +    T  R    +   CC 
Sbjct: 2119 PPGTPTRGTTTGSSSAPTPSTVQTTTTSAWTPTPTPLSTPSIIRTTGLRPYPSSVLICCV 2178

Query: 687  ---TCRPPTSSTW-------------AMSRRWARLPATSPSTPSSPRRCRASRAPTPSAL 818
               T   P    +             ++S        + PSTPS          PTPS  
Sbjct: 2179 LNDTYYAPGEEVYNGTYGDTCYFVNCSLSCTLEFYNWSCPSTPSP--------TPTPSK- 2229

Query: 819  STGTPSTASSPSS 857
            ST TPS  SS  S
Sbjct: 2230 STPTPSKPSSTPS 2242

 Score = 34.3 bits (77), Expect = 4.0
 Identities = 27/102 (26%), Positives = 34/102 (32%), Gaps = 12/102 (11%)
 Frame = +3

Query: 9    CASSPPPAPSPWTTPPCTSPPTSRPSSQRLASLSP-----PTPARAAACWRASTRCTATS 173
            C S+P P P+P  + P  S P+S PS     +  P       P +    W       AT 
Sbjct: 2217 CPSTPSPTPTPSKSTPTPSKPSSTPSKPTPGTKPPECPDFDPPRQENETWWLCDCFMATC 2276

Query: 174  APSRT-------SPPSTRWTCLNPSCPARTSPCSWPCWSPAC 278
              + T         P    TC N   P R       CW   C
Sbjct: 2277 KYNNTVEIVKVECEPPPMPTCSNGLQPVRVEDPDGCCWHWEC 2318

>gb|AAA59163.1| mucin
          Length = 1270

 Score =  112 bits (281), Expect = 9e-24
 Identities = 115/398 (28%), Positives = 152/398 (37%), Gaps = 28/398 (7%)
 Frame = +3

Query: 9    CASSPPP---APSPWTTPPCTSPPTSRPSSQRLASLSPPTPARAAACWRASTRCTATSAP 179
            C ++P P    PSP  T   T PPT+ PS     + +PP     +     +T    T+ P
Sbjct: 770  CITTPSPPTTTPSPPPTTTTTLPPTTTPSPPTTTTTTPPPTTTPSPPITTTTTPLPTTTP 829

Query: 180  S-----RTSPPSTRWTCLNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAPP---- 332
            S      T+PP T  T  +P     + P + P         PPP     TT P+PP    
Sbjct: 830  SPPISTTTTPPPT--TTPSPPTTTPSPPTTTPSPPTTTTTTPPP-----TTTPSPPMTTP 882

Query: 333  --PPEPRTTAAAICWPPPPDPACS---PWTSPAPPSTLRLASATWSTAAASPTWAS*FAP 497
              PP   TT      P PP    +   P T+P+PP+T  +   T ST    PT      P
Sbjct: 883  ITPPASTTTLPPTTTPSPPTTTTTTPPPTTTPSPPTTTPITPPT-STTTLPPTTTPSPPP 941

Query: 498  CRRTTPPPACSACRSWTPAPAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCR 677
               TTPPP  +     T  P+P        T  TP  T      T T T    +T  S  
Sbjct: 942  TTTTTPPPTTTPSPPTTTTPSP-----PTITTTTPPPTTTPSPPTTTTTTPPPTTTPSPP 996

Query: 678  CCATCRPPTSSTWAMSRRWARLPATSPST--PSSPRRCRASRAPTPSALSTGTPSTASSP 851
                  PPTS+T          P T+ +T  P++      +  P+P   +T TP   ++P
Sbjct: 997  TTTPITPPTSTTTLPPTTTPSPPPTTTTTPPPTTTPSPPTTTTPSPPITTTTTPPPTTTP 1056

Query: 852  SSSS*TTPR--WASCATWSRTLSWLSP-PARWPPQPSSRPRPPAAPWAACRAWARPSACL 1022
            SS   TTP     +  T S T +  SP      P  ++ P PP            P+   
Sbjct: 1057 SSPITTTPSPPTTTMTTPSPTTTPSSPITTTTTPSSTTTPSPP------------PTTMT 1104

Query: 1023 CPRSAGPSWAPATAATCCPP----SPLST--FTPSSTP 1118
             P        P T  T  PP    SPL+T    PS TP
Sbjct: 1105 TPSPTTTPSPPTTTMTTLPPTTTSSPLTTTPLPPSITP 1142

 Score =  104 bits (259), Expect = 3e-21
 Identities = 118/406 (29%), Positives = 161/406 (39%), Gaps = 47/406 (11%)
 Frame = +3

Query: 15   SSPPPA--PSPWTTPPCTSPPTSRPSSQRLASLSPP---TPARAAACWRASTRCTATSAP 179
            ++PPP   PSP TT P  SPPT+ PS     + +PP   TP+            T T  P
Sbjct: 837  TTPPPTTTPSPPTTTP--SPPTTTPSPPTTTTTTPPPTTTPSPPMTTPITPPASTTTLPP 894

Query: 180  SRT-SPPSTRWTCLNPSC---PARTSPCSWPCWS----PACCPVPPPWTAVCTTPPAPP- 332
            + T SPP+T  T   P+    P  T+P + P  +    P   P PPP T   TTPP  P 
Sbjct: 895  TTTPSPPTTTTTTPPPTTTPSPPTTTPITPPTSTTTLPPTTTPSPPPTTT--TTPP--PT 950

Query: 333  -PPEPRTTAA------AICWPPP---PDPACS------PWTSPAPPSTLRLASATWSTAA 464
              P P TT            PPP   P P  +      P T+P+PP+T  +   T ST  
Sbjct: 951  TTPSPPTTTTPSPPTITTTTPPPTTTPSPPTTTTTTPPPTTTPSPPTTTPITPPT-STTT 1009

Query: 465  ASPTWAS*FAPCRRTTPPPACSACRSWTPAPAPFRSGRRRHTLRTPTWTPLMCAATATPT 644
              PT      P   TTPPP  +     T  P+P                P+    T  PT
Sbjct: 1010 LPPTTTPSPPPTTTTTPPPTTTPSPPTTTTPSP----------------PITTTTTPPPT 1053

Query: 645  RCRASTWNSCRCCATCRPPTSSTWAMSRRWARLPATSPSTPSSPRRCRASR---APTPSA 815
                 T  S     T  PPT++    S      P T+PS+P +     +S    +P P+ 
Sbjct: 1054 -----TTPSSPITTTPSPPTTTMTTPS------PTTTPSSPITTTTTPSSTTTPSPPPTT 1102

Query: 816  LSTGTPSTASSPSSSS*TT--PRWASCATWSRTLSWLSPPARWPPQPSSRPRPPAAPWAA 989
            ++T +P+T  SP +++ TT  P   S    +  L     P  + P  ++ P  P  P   
Sbjct: 1103 MTTPSPTTTPSPPTTTMTTLPPTTTSSPLTTTPLPPSITPPTFSPFSTTTPTTPCVPLCN 1162

Query: 990  CRAW---ARPS-------ACLCPRSAGPSWAP--ATAATCCPPSPL 1091
               W    +P+         L     GP WA   +  AT  P  P+
Sbjct: 1163 WTGWLDSGKPNFHKPGGDTELIGDVCGPGWAANISCRATMYPDVPI 1208

 Score = 89.0 bits (219), Expect = 1e-16
 Identities = 94/332 (28%), Positives = 121/332 (36%), Gaps = 4/332 (1%)
 Frame = +3

Query: 126  RAAACWRASTRCTATSAPSRT-SPPSTRWTCLNPSCPARTSPCSWPCWSPACCPVPPPWT 302
            R   CW      T  S P+ T SPP T  T L P+    T+P              PP T
Sbjct: 760  RVNCCWPMDKCITTPSPPTTTPSPPPTTTTTLPPT----TTPS-------------PPTT 802

Query: 303  AVCTTPPAPPPPEPRTTAAAICWPPPPDPACSPWTSPAPPSTLRLASATWSTAAASPTWA 482
               T PP   P  P TT         P P  S  T+P P +T    + T S    +P+  
Sbjct: 803  TTTTPPPTTTPSPPITTTTTPLPTTTPSPPISTTTTPPPTTTPSPPTTTPSPPTTTPSPP 862

Query: 483  S*FAPCRRTTPPPACSACRSWTPAPAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRAST 662
            +       TTPPP  +     T    P  S     T   PT TP     T T T    +T
Sbjct: 863  T----TTTTTPPPTTTPSPPMTTPITPPAS----TTTLPPTTTP--SPPTTTTTTPPPTT 912

Query: 663  WNSCRCCATCRPPTSSTWAMSRRWARLPATSPSTPSSPRRCRASRAPTPSALSTGTPSTA 842
              S        PPTS+T          P T+PS P +      +  P P+   +   +T 
Sbjct: 913  TPSPPTTTPITPPTSTT-------TLPPTTTPSPPPT-----TTTTPPPTTTPSPPTTTT 960

Query: 843  SSPSSSS*TTPRWASCATWSRTLSWLSPPARWPPQPSSRPRPPAAPWAACRAWARPSACL 1022
             SP + + TTP   +  +   T +   PP   P  P++ P  P             S   
Sbjct: 961  PSPPTITTTTPPPTTTPSPPTTTTTTPPPTTTPSPPTTTPITPPT-----------STTT 1009

Query: 1023 CPRSAGPSWAPATAATCCP---PSPLSTFTPS 1109
             P +  PS  P T  T  P   PSP +T TPS
Sbjct: 1010 LPPTTTPSPPPTTTTTPPPTTTPSPPTTTTPS 1041

 Score = 61.6 bits (148), Expect = 2e-08
 Identities = 57/187 (30%), Positives = 73/187 (38%), Gaps = 5/187 (2%)
 Frame = +3

Query: 3    PWCASSPPPAPSPWTTPPCT--SPPTSRPSSQRLASLSPPTPARAAACWRASTRCTATSA 176
            P    SPPP  +  T PP T  SPPT+   S  + + + P P             T  S+
Sbjct: 1012 PTTTPSPPPTTT-TTPPPTTTPSPPTTTTPSPPITTTTTPPPT------------TTPSS 1058

Query: 177  PSRT--SPPSTRWTCLNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAPPPPEPRT 350
            P  T  SPP+T  T  +P+    +   +    S    P PPP T    +P   P P P T
Sbjct: 1059 PITTTPSPPTTTMTTPSPTTTPSSPITTTTTPSSTTTPSPPPTTMTTPSPTTTPSP-PTT 1117

Query: 351  TAAAICWPPPPDPACSP-WTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPAC 527
            T   +    PP    SP  T+P PPS               PT    F+P   TTP   C
Sbjct: 1118 TMTTL----PPTTTSSPLTTTPLPPS------------ITPPT----FSPFSTTTPTTPC 1157

Query: 528  SACRSWT 548
                +WT
Sbjct: 1158 VPLCNWT 1164

>ref|NP_002448.1| mucin 2 [Homo sapiens] gi|2506877|sp|Q02817|MUC2_HUMAN Mucin 2
            precursor (Intestinal mucin 2) gi|454154|gb|AAB95295.1|
            mucin [Homo sapiens]
          Length = 5179

 Score =  112 bits (281), Expect = 9e-24
 Identities = 115/398 (28%), Positives = 152/398 (37%), Gaps = 28/398 (7%)
 Frame = +3

Query: 9    CASSPPP---APSPWTTPPCTSPPTSRPSSQRLASLSPPTPARAAACWRASTRCTATSAP 179
            C ++P P    PSP  T   T PPT+ PS     + +PP     +     +T    T+ P
Sbjct: 1395 CITTPSPPTTTPSPPPTTTTTLPPTTTPSPPTTTTTTPPPTTTPSPPITTTTTPLPTTTP 1454

Query: 180  S-----RTSPPSTRWTCLNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAPP---- 332
            S      T+PP T  T  +P     + P + P         PPP     TT P+PP    
Sbjct: 1455 SPPISTTTTPPPT--TTPSPPTTTPSPPTTTPSPPTTTTTTPPP-----TTTPSPPMTTP 1507

Query: 333  --PPEPRTTAAAICWPPPPDPACS---PWTSPAPPSTLRLASATWSTAAASPTWAS*FAP 497
              PP   TT      P PP    +   P T+P+PP+T  +   T ST    PT      P
Sbjct: 1508 ITPPASTTTLPPTTTPSPPTTTTTTPPPTTTPSPPTTTPITPPT-STTTLPPTTTPSPPP 1566

Query: 498  CRRTTPPPACSACRSWTPAPAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCR 677
               TTPPP  +     T  P+P        T  TP  T      T T T    +T  S  
Sbjct: 1567 TTTTTPPPTTTPSPPTTTTPSP-----PTITTTTPPPTTTPSPPTTTTTTPPPTTTPSPP 1621

Query: 678  CCATCRPPTSSTWAMSRRWARLPATSPST--PSSPRRCRASRAPTPSALSTGTPSTASSP 851
                  PPTS+T          P T+ +T  P++      +  P+P   +T TP   ++P
Sbjct: 1622 TTTPITPPTSTTTLPPTTTPSPPPTTTTTPPPTTTPSPPTTTTPSPPITTTTTPPPTTTP 1681

Query: 852  SSSS*TTPR--WASCATWSRTLSWLSP-PARWPPQPSSRPRPPAAPWAACRAWARPSACL 1022
            SS   TTP     +  T S T +  SP      P  ++ P PP            P+   
Sbjct: 1682 SSPITTTPSPPTTTMTTPSPTTTPSSPITTTTTPSSTTTPSPP------------PTTMT 1729

Query: 1023 CPRSAGPSWAPATAATCCPP----SPLST--FTPSSTP 1118
             P        P T  T  PP    SPL+T    PS TP
Sbjct: 1730 TPSPTTTPSPPTTTMTTLPPTTTSSPLTTTPLPPSITP 1767

 Score =  104 bits (259), Expect = 3e-21
 Identities = 118/406 (29%), Positives = 161/406 (39%), Gaps = 47/406 (11%)
 Frame = +3

Query: 15   SSPPPA--PSPWTTPPCTSPPTSRPSSQRLASLSPP---TPARAAACWRASTRCTATSAP 179
            ++PPP   PSP TT P  SPPT+ PS     + +PP   TP+            T T  P
Sbjct: 1462 TTPPPTTTPSPPTTTP--SPPTTTPSPPTTTTTTPPPTTTPSPPMTTPITPPASTTTLPP 1519

Query: 180  SRT-SPPSTRWTCLNPSC---PARTSPCSWPCWS----PACCPVPPPWTAVCTTPPAPP- 332
            + T SPP+T  T   P+    P  T+P + P  +    P   P PPP T   TTPP  P 
Sbjct: 1520 TTTPSPPTTTTTTPPPTTTPSPPTTTPITPPTSTTTLPPTTTPSPPPTTT--TTPP--PT 1575

Query: 333  -PPEPRTTAA------AICWPPP---PDPACS------PWTSPAPPSTLRLASATWSTAA 464
              P P TT            PPP   P P  +      P T+P+PP+T  +   T ST  
Sbjct: 1576 TTPSPPTTTTPSPPTITTTTPPPTTTPSPPTTTTTTPPPTTTPSPPTTTPITPPT-STTT 1634

Query: 465  ASPTWAS*FAPCRRTTPPPACSACRSWTPAPAPFRSGRRRHTLRTPTWTPLMCAATATPT 644
              PT      P   TTPPP  +     T  P+P                P+    T  PT
Sbjct: 1635 LPPTTTPSPPPTTTTTPPPTTTPSPPTTTTPSP----------------PITTTTTPPPT 1678

Query: 645  RCRASTWNSCRCCATCRPPTSSTWAMSRRWARLPATSPSTPSSPRRCRASR---APTPSA 815
                 T  S     T  PPT++    S      P T+PS+P +     +S    +P P+ 
Sbjct: 1679 -----TTPSSPITTTPSPPTTTMTTPS------PTTTPSSPITTTTTPSSTTTPSPPPTT 1727

Query: 816  LSTGTPSTASSPSSSS*TT--PRWASCATWSRTLSWLSPPARWPPQPSSRPRPPAAPWAA 989
            ++T +P+T  SP +++ TT  P   S    +  L     P  + P  ++ P  P  P   
Sbjct: 1728 MTTPSPTTTPSPPTTTMTTLPPTTTSSPLTTTPLPPSITPPTFSPFSTTTPTTPCVPLCN 1787

Query: 990  CRAW---ARPS-------ACLCPRSAGPSWAP--ATAATCCPPSPL 1091
               W    +P+         L     GP WA   +  AT  P  P+
Sbjct: 1788 WTGWLDSGKPNFHKPGGDTELIGDVCGPGWAANISCRATMYPDVPI 1833

 Score = 89.0 bits (219), Expect = 1e-16
 Identities = 94/332 (28%), Positives = 121/332 (36%), Gaps = 4/332 (1%)
 Frame = +3

Query: 126  RAAACWRASTRCTATSAPSRT-SPPSTRWTCLNPSCPARTSPCSWPCWSPACCPVPPPWT 302
            R   CW      T  S P+ T SPP T  T L P+    T+P              PP T
Sbjct: 1385 RVNCCWPMDKCITTPSPPTTTPSPPPTTTTTLPPT----TTPS-------------PPTT 1427

Query: 303  AVCTTPPAPPPPEPRTTAAAICWPPPPDPACSPWTSPAPPSTLRLASATWSTAAASPTWA 482
               T PP   P  P TT         P P  S  T+P P +T    + T S    +P+  
Sbjct: 1428 TTTTPPPTTTPSPPITTTTTPLPTTTPSPPISTTTTPPPTTTPSPPTTTPSPPTTTPSPP 1487

Query: 483  S*FAPCRRTTPPPACSACRSWTPAPAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRAST 662
            +       TTPPP  +     T    P  S     T   PT TP     T T T    +T
Sbjct: 1488 T----TTTTTPPPTTTPSPPMTTPITPPAS----TTTLPPTTTP--SPPTTTTTTPPPTT 1537

Query: 663  WNSCRCCATCRPPTSSTWAMSRRWARLPATSPSTPSSPRRCRASRAPTPSALSTGTPSTA 842
              S        PPTS+T          P T+PS P +      +  P P+   +   +T 
Sbjct: 1538 TPSPPTTTPITPPTSTT-------TLPPTTTPSPPPT-----TTTTPPPTTTPSPPTTTT 1585

Query: 843  SSPSSSS*TTPRWASCATWSRTLSWLSPPARWPPQPSSRPRPPAAPWAACRAWARPSACL 1022
             SP + + TTP   +  +   T +   PP   P  P++ P  P             S   
Sbjct: 1586 PSPPTITTTTPPPTTTPSPPTTTTTTPPPTTTPSPPTTTPITPPT-----------STTT 1634

Query: 1023 CPRSAGPSWAPATAATCCP---PSPLSTFTPS 1109
             P +  PS  P T  T  P   PSP +T TPS
Sbjct: 1635 LPPTTTPSPPPTTTTTPPPTTTPSPPTTTTPS 1666

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 89/381 (23%), Positives = 133/381 (34%), Gaps = 11/381 (2%)
 Frame = +3

Query: 9    CASSPPPAPSPWTTPPCTSPPTSRPSSQRLASLSPPTP--ARAAACWRASTRCTATSAPS 182
            C     P     TT    +PPT+ P +        PTP   +       +T  T T  P+
Sbjct: 1876 CECVTQPTTMTTTTTENPTPPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 1935

Query: 183  RTSPPSTRWTCLNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPA---PPPPEPRTT 353
             T   +   T +  +     +P      +P   P+    T   T  P     P   P TT
Sbjct: 1936 PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT 1995

Query: 354  AAAICWPPPPDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPACSA 533
               +   P P    +P T+P   +T    + T  T   +PT          TTP    + 
Sbjct: 1996 TTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT-PTGTQTPT----------TTP---ITT 2041

Query: 534  CRSWTPAPAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSST 713
              + TP P P  +       +TPT TP+    T TPT     T        T  P T++T
Sbjct: 2042 TTTVTPTPTPTGT-------QTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTT 2089

Query: 714  WAMSRRWARLPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPRWASC 890
                      P  + +  ++P     +  PTP+   T TP+T    ++++ T TP     
Sbjct: 2090 TVTP---TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT 2146

Query: 891  ATWSRTLSWLSPPARWPPQPSSRPRPPAAPWAACRAWARPSACLCPRSAG---PSWAPAT 1061
             T + T    +      P P+    P   P          +    P   G   P+  P T
Sbjct: 2147 QTPTTTPITTTTTVTPTPTPTGTQTPTTTP-----ITTTTTVTPTPTPTGTQTPTTTPIT 2201

Query: 1062 AATCC--PPSPLSTFTPSSTP 1118
              T     P+P  T TP++TP
Sbjct: 2202 TTTTVTPTPTPTGTQTPTTTP 2222

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 88/372 (23%), Positives = 132/372 (34%), Gaps = 11/372 (2%)
 Frame = +3

Query: 36   SPWTTPPCTSPPTSRPSSQRLASLSPPTP--ARAAACWRASTRCTATSAPSRTSPPSTRW 209
            +P  TP  T  PT+ P +        PTP   +       +T  T T  P+ T   +   
Sbjct: 3173 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 3232

Query: 210  TCLNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPA---PPPPEPRTTAAAICWPPP 380
            T +  +     +P      +P   P+    T   T  P     P   P TT   +   P 
Sbjct: 3233 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 3292

Query: 381  PDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPACSACRSWTPAPA 560
            P    +P T+P   +T    + T  T   +PT          TTP    +   + TP P 
Sbjct: 3293 PTGTQTPTTTPITTTTTVTPTPT-PTGTQTPT----------TTP---ITTTTTVTPTPT 3338

Query: 561  PFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSSTWAMSRRWAR 740
            P  +       +TPT TP+    T TPT     T        T  P T++T         
Sbjct: 3339 PTGT-------QTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVTP---TP 3383

Query: 741  LPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPRWASCATWSRTLSW 917
             P  + +  ++P     +  PTP+   T TP+T    ++++ T TP      T + T   
Sbjct: 3384 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 3443

Query: 918  LSPPARWPPQPSSRPRPPAAPWAACRAWARPSACLCPRSAG---PSWAPATAATCC--PP 1082
             +      P P+    P   P          +    P   G   P+  P T  T     P
Sbjct: 3444 TTTTVTPTPTPTGTQTPTTTP-----ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 3498

Query: 1083 SPLSTFTPSSTP 1118
            +P  T TP++TP
Sbjct: 3499 TPTGTQTPTTTP 3510

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 88/372 (23%), Positives = 132/372 (34%), Gaps = 11/372 (2%)
 Frame = +3

Query: 36   SPWTTPPCTSPPTSRPSSQRLASLSPPTP--ARAAACWRASTRCTATSAPSRTSPPSTRW 209
            +P  TP  T  PT+ P +        PTP   +       +T  T T  P+ T   +   
Sbjct: 3541 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 3600

Query: 210  TCLNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPA---PPPPEPRTTAAAICWPPP 380
            T +  +     +P      +P   P+    T   T  P     P   P TT   +   P 
Sbjct: 3601 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 3660

Query: 381  PDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPACSACRSWTPAPA 560
            P    +P T+P   +T    + T  T   +PT          TTP    +   + TP P 
Sbjct: 3661 PTGTQTPTTTPITTTTTVTPTPT-PTGTQTPT----------TTP---ITTTTTVTPTPT 3706

Query: 561  PFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSSTWAMSRRWAR 740
            P  +       +TPT TP+    T TPT     T        T  P T++T         
Sbjct: 3707 PTGT-------QTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVTP---TP 3751

Query: 741  LPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPRWASCATWSRTLSW 917
             P  + +  ++P     +  PTP+   T TP+T    ++++ T TP      T + T   
Sbjct: 3752 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 3811

Query: 918  LSPPARWPPQPSSRPRPPAAPWAACRAWARPSACLCPRSAG---PSWAPATAATCC--PP 1082
             +      P P+    P   P          +    P   G   P+  P T  T     P
Sbjct: 3812 TTTTVTPTPTPTGTQTPTTTP-----ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 3866

Query: 1083 SPLSTFTPSSTP 1118
            +P  T TP++TP
Sbjct: 3867 TPTGTQTPTTTP 3878

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 88/372 (23%), Positives = 132/372 (34%), Gaps = 11/372 (2%)
 Frame = +3

Query: 36   SPWTTPPCTSPPTSRPSSQRLASLSPPTP--ARAAACWRASTRCTATSAPSRTSPPSTRW 209
            +P  TP  T  PT+ P +        PTP   +       +T  T T  P+ T   +   
Sbjct: 2207 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 2266

Query: 210  TCLNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPA---PPPPEPRTTAAAICWPPP 380
            T +  +     +P      +P   P+    T   T  P     P   P TT   +   P 
Sbjct: 2267 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 2326

Query: 381  PDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPACSACRSWTPAPA 560
            P    +P T+P   +T    + T  T   +PT          TTP    +   + TP P 
Sbjct: 2327 PTGTQTPTTTPITTTTTVTPTPT-PTGTQTPT----------TTP---ITTTTTVTPTPT 2372

Query: 561  PFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSSTWAMSRRWAR 740
            P  +       +TPT TP+    T TPT     T        T  P T++T         
Sbjct: 2373 PTGT-------QTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVTP---TP 2417

Query: 741  LPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPRWASCATWSRTLSW 917
             P  + +  ++P     +  PTP+   T TP+T    ++++ T TP      T + T   
Sbjct: 2418 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 2477

Query: 918  LSPPARWPPQPSSRPRPPAAPWAACRAWARPSACLCPRSAG---PSWAPATAATCC--PP 1082
             +      P P+    P   P          +    P   G   P+  P T  T     P
Sbjct: 2478 TTTTVTPTPTPTGTQTPTTTP-----ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 2532

Query: 1083 SPLSTFTPSSTP 1118
            +P  T TP++TP
Sbjct: 2533 TPTGTQTPTTTP 2544

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 88/372 (23%), Positives = 132/372 (34%), Gaps = 11/372 (2%)
 Frame = +3

Query: 36   SPWTTPPCTSPPTSRPSSQRLASLSPPTP--ARAAACWRASTRCTATSAPSRTSPPSTRW 209
            +P  TP  T  PT+ P +        PTP   +       +T  T T  P+ T   +   
Sbjct: 2667 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 2726

Query: 210  TCLNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPA---PPPPEPRTTAAAICWPPP 380
            T +  +     +P      +P   P+    T   T  P     P   P TT   +   P 
Sbjct: 2727 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 2786

Query: 381  PDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPACSACRSWTPAPA 560
            P    +P T+P   +T    + T  T   +PT          TTP    +   + TP P 
Sbjct: 2787 PTGTQTPTTTPITTTTTVTPTPT-PTGTQTPT----------TTP---ITTTTTVTPTPT 2832

Query: 561  PFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSSTWAMSRRWAR 740
            P  +       +TPT TP+    T TPT     T        T  P T++T         
Sbjct: 2833 PTGT-------QTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVTP---TP 2877

Query: 741  LPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPRWASCATWSRTLSW 917
             P  + +  ++P     +  PTP+   T TP+T    ++++ T TP      T + T   
Sbjct: 2878 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 2937

Query: 918  LSPPARWPPQPSSRPRPPAAPWAACRAWARPSACLCPRSAG---PSWAPATAATCC--PP 1082
             +      P P+    P   P          +    P   G   P+  P T  T     P
Sbjct: 2938 TTTTVTPTPTPTGTQTPTTTP-----ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 2992

Query: 1083 SPLSTFTPSSTP 1118
            +P  T TP++TP
Sbjct: 2993 TPTGTQTPTTTP 3004

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 88/372 (23%), Positives = 132/372 (34%), Gaps = 11/372 (2%)
 Frame = +3

Query: 36   SPWTTPPCTSPPTSRPSSQRLASLSPPTP--ARAAACWRASTRCTATSAPSRTSPPSTRW 209
            +P  TP  T  PT+ P +        PTP   +       +T  T T  P+ T   +   
Sbjct: 2920 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 2979

Query: 210  TCLNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPA---PPPPEPRTTAAAICWPPP 380
            T +  +     +P      +P   P+    T   T  P     P   P TT   +   P 
Sbjct: 2980 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 3039

Query: 381  PDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPACSACRSWTPAPA 560
            P    +P T+P   +T    + T  T   +PT          TTP    +   + TP P 
Sbjct: 3040 PTGTQTPTTTPITTTTTVTPTPT-PTGTQTPT----------TTP---ITTTTTVTPTPT 3085

Query: 561  PFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSSTWAMSRRWAR 740
            P  +       +TPT TP+    T TPT     T        T  P T++T         
Sbjct: 3086 PTGT-------QTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVTP---TP 3130

Query: 741  LPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPRWASCATWSRTLSW 917
             P  + +  ++P     +  PTP+   T TP+T    ++++ T TP      T + T   
Sbjct: 3131 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 3190

Query: 918  LSPPARWPPQPSSRPRPPAAPWAACRAWARPSACLCPRSAG---PSWAPATAATCC--PP 1082
             +      P P+    P   P          +    P   G   P+  P T  T     P
Sbjct: 3191 TTTTVTPTPTPTGTQTPTTTP-----ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 3245

Query: 1083 SPLSTFTPSSTP 1118
            +P  T TP++TP
Sbjct: 3246 TPTGTQTPTTTP 3257

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 88/372 (23%), Positives = 132/372 (34%), Gaps = 11/372 (2%)
 Frame = +3

Query: 36   SPWTTPPCTSPPTSRPSSQRLASLSPPTP--ARAAACWRASTRCTATSAPSRTSPPSTRW 209
            +P  TP  T  PT+ P +        PTP   +       +T  T T  P+ T   +   
Sbjct: 3288 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 3347

Query: 210  TCLNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPA---PPPPEPRTTAAAICWPPP 380
            T +  +     +P      +P   P+    T   T  P     P   P TT   +   P 
Sbjct: 3348 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 3407

Query: 381  PDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPACSACRSWTPAPA 560
            P    +P T+P   +T    + T  T   +PT          TTP    +   + TP P 
Sbjct: 3408 PTGTQTPTTTPITTTTTVTPTPT-PTGTQTPT----------TTP---ITTTTTVTPTPT 3453

Query: 561  PFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSSTWAMSRRWAR 740
            P  +       +TPT TP+    T TPT     T        T  P T++T         
Sbjct: 3454 PTGT-------QTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVTP---TP 3498

Query: 741  LPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPRWASCATWSRTLSW 917
             P  + +  ++P     +  PTP+   T TP+T    ++++ T TP      T + T   
Sbjct: 3499 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 3558

Query: 918  LSPPARWPPQPSSRPRPPAAPWAACRAWARPSACLCPRSAG---PSWAPATAATCC--PP 1082
             +      P P+    P   P          +    P   G   P+  P T  T     P
Sbjct: 3559 TTTTVTPTPTPTGTQTPTTTP-----ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 3613

Query: 1083 SPLSTFTPSSTP 1118
            +P  T TP++TP
Sbjct: 3614 TPTGTQTPTTTP 3625

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 88/372 (23%), Positives = 132/372 (34%), Gaps = 11/372 (2%)
 Frame = +3

Query: 36   SPWTTPPCTSPPTSRPSSQRLASLSPPTP--ARAAACWRASTRCTATSAPSRTSPPSTRW 209
            +P  TP  T  PT+ P +        PTP   +       +T  T T  P+ T   +   
Sbjct: 3794 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 3853

Query: 210  TCLNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPA---PPPPEPRTTAAAICWPPP 380
            T +  +     +P      +P   P+    T   T  P     P   P TT   +   P 
Sbjct: 3854 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 3913

Query: 381  PDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPACSACRSWTPAPA 560
            P    +P T+P   +T    + T  T   +PT          TTP    +   + TP P 
Sbjct: 3914 PTGTQTPTTTPITTTTTVTPTPT-PTGTQTPT----------TTP---ITTTTTVTPTPT 3959

Query: 561  PFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSSTWAMSRRWAR 740
            P  +       +TPT TP+    T TPT     T        T  P T++T         
Sbjct: 3960 PTGT-------QTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVTP---TP 4004

Query: 741  LPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPRWASCATWSRTLSW 917
             P  + +  ++P     +  PTP+   T TP+T    ++++ T TP      T + T   
Sbjct: 4005 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 4064

Query: 918  LSPPARWPPQPSSRPRPPAAPWAACRAWARPSACLCPRSAG---PSWAPATAATCC--PP 1082
             +      P P+    P   P          +    P   G   P+  P T  T     P
Sbjct: 4065 TTTTVTPTPTPTGTQTPTTTP-----ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 4119

Query: 1083 SPLSTFTPSSTP 1118
            +P  T TP++TP
Sbjct: 4120 TPTGTQTPTTTP 4131

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 88/372 (23%), Positives = 132/372 (34%), Gaps = 11/372 (2%)
 Frame = +3

Query: 36   SPWTTPPCTSPPTSRPSSQRLASLSPPTP--ARAAACWRASTRCTATSAPSRTSPPSTRW 209
            +P  TP  T  PT+ P +        PTP   +       +T  T T  P+ T   +   
Sbjct: 3564 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 3623

Query: 210  TCLNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPA---PPPPEPRTTAAAICWPPP 380
            T +  +     +P      +P   P+    T   T  P     P   P TT   +   P 
Sbjct: 3624 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 3683

Query: 381  PDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPACSACRSWTPAPA 560
            P    +P T+P   +T    + T  T   +PT          TTP    +   + TP P 
Sbjct: 3684 PTGTQTPTTTPITTTTTVTPTPT-PTGTQTPT----------TTP---ITTTTTVTPTPT 3729

Query: 561  PFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSSTWAMSRRWAR 740
            P  +       +TPT TP+    T TPT     T        T  P T++T         
Sbjct: 3730 PTGT-------QTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVTP---TP 3774

Query: 741  LPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPRWASCATWSRTLSW 917
             P  + +  ++P     +  PTP+   T TP+T    ++++ T TP      T + T   
Sbjct: 3775 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 3834

Query: 918  LSPPARWPPQPSSRPRPPAAPWAACRAWARPSACLCPRSAG---PSWAPATAATCC--PP 1082
             +      P P+    P   P          +    P   G   P+  P T  T     P
Sbjct: 3835 TTTTVTPTPTPTGTQTPTTTP-----ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 3889

Query: 1083 SPLSTFTPSSTP 1118
            +P  T TP++TP
Sbjct: 3890 TPTGTQTPTTTP 3901

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 88/372 (23%), Positives = 132/372 (34%), Gaps = 11/372 (2%)
 Frame = +3

Query: 36   SPWTTPPCTSPPTSRPSSQRLASLSPPTP--ARAAACWRASTRCTATSAPSRTSPPSTRW 209
            +P  TP  T  PT+ P +        PTP   +       +T  T T  P+ T   +   
Sbjct: 3196 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 3255

Query: 210  TCLNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPA---PPPPEPRTTAAAICWPPP 380
            T +  +     +P      +P   P+    T   T  P     P   P TT   +   P 
Sbjct: 3256 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 3315

Query: 381  PDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPACSACRSWTPAPA 560
            P    +P T+P   +T    + T  T   +PT          TTP    +   + TP P 
Sbjct: 3316 PTGTQTPTTTPITTTTTVTPTPT-PTGTQTPT----------TTP---ITTTTTVTPTPT 3361

Query: 561  PFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSSTWAMSRRWAR 740
            P  +       +TPT TP+    T TPT     T        T  P T++T         
Sbjct: 3362 PTGT-------QTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVTP---TP 3406

Query: 741  LPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPRWASCATWSRTLSW 917
             P  + +  ++P     +  PTP+   T TP+T    ++++ T TP      T + T   
Sbjct: 3407 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 3466

Query: 918  LSPPARWPPQPSSRPRPPAAPWAACRAWARPSACLCPRSAG---PSWAPATAATCC--PP 1082
             +      P P+    P   P          +    P   G   P+  P T  T     P
Sbjct: 3467 TTTTVTPTPTPTGTQTPTTTP-----ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 3521

Query: 1083 SPLSTFTPSSTP 1118
            +P  T TP++TP
Sbjct: 3522 TPTGTQTPTTTP 3533

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 88/372 (23%), Positives = 132/372 (34%), Gaps = 11/372 (2%)
 Frame = +3

Query: 36   SPWTTPPCTSPPTSRPSSQRLASLSPPTP--ARAAACWRASTRCTATSAPSRTSPPSTRW 209
            +P  TP  T  PT+ P +        PTP   +       +T  T T  P+ T   +   
Sbjct: 2460 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 2519

Query: 210  TCLNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPA---PPPPEPRTTAAAICWPPP 380
            T +  +     +P      +P   P+    T   T  P     P   P TT   +   P 
Sbjct: 2520 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 2579

Query: 381  PDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPACSACRSWTPAPA 560
            P    +P T+P   +T    + T  T   +PT          TTP    +   + TP P 
Sbjct: 2580 PTGTQTPTTTPITTTTTVTPTPT-PTGTQTPT----------TTP---ITTTTTVTPTPT 2625

Query: 561  PFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSSTWAMSRRWAR 740
            P  +       +TPT TP+    T TPT     T        T  P T++T         
Sbjct: 2626 PTGT-------QTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVTP---TP 2670

Query: 741  LPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPRWASCATWSRTLSW 917
             P  + +  ++P     +  PTP+   T TP+T    ++++ T TP      T + T   
Sbjct: 2671 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 2730

Query: 918  LSPPARWPPQPSSRPRPPAAPWAACRAWARPSACLCPRSAG---PSWAPATAATCC--PP 1082
             +      P P+    P   P          +    P   G   P+  P T  T     P
Sbjct: 2731 TTTTVTPTPTPTGTQTPTTTP-----ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 2785

Query: 1083 SPLSTFTPSSTP 1118
            +P  T TP++TP
Sbjct: 2786 TPTGTQTPTTTP 2797

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 88/372 (23%), Positives = 132/372 (34%), Gaps = 11/372 (2%)
 Frame = +3

Query: 36   SPWTTPPCTSPPTSRPSSQRLASLSPPTP--ARAAACWRASTRCTATSAPSRTSPPSTRW 209
            +P  TP  T  PT+ P +        PTP   +       +T  T T  P+ T   +   
Sbjct: 2575 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 2634

Query: 210  TCLNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPA---PPPPEPRTTAAAICWPPP 380
            T +  +     +P      +P   P+    T   T  P     P   P TT   +   P 
Sbjct: 2635 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 2694

Query: 381  PDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPACSACRSWTPAPA 560
            P    +P T+P   +T    + T  T   +PT          TTP    +   + TP P 
Sbjct: 2695 PTGTQTPTTTPITTTTTVTPTPT-PTGTQTPT----------TTP---ITTTTTVTPTPT 2740

Query: 561  PFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSSTWAMSRRWAR 740
            P  +       +TPT TP+    T TPT     T        T  P T++T         
Sbjct: 2741 PTGT-------QTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVTP---TP 2785

Query: 741  LPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPRWASCATWSRTLSW 917
             P  + +  ++P     +  PTP+   T TP+T    ++++ T TP      T + T   
Sbjct: 2786 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 2845

Query: 918  LSPPARWPPQPSSRPRPPAAPWAACRAWARPSACLCPRSAG---PSWAPATAATCC--PP 1082
             +      P P+    P   P          +    P   G   P+  P T  T     P
Sbjct: 2846 TTTTVTPTPTPTGTQTPTTTP-----ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 2900

Query: 1083 SPLSTFTPSSTP 1118
            +P  T TP++TP
Sbjct: 2901 TPTGTQTPTTTP 2912

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 88/372 (23%), Positives = 132/372 (34%), Gaps = 11/372 (2%)
 Frame = +3

Query: 36   SPWTTPPCTSPPTSRPSSQRLASLSPPTP--ARAAACWRASTRCTATSAPSRTSPPSTRW 209
            +P  TP  T  PT+ P +        PTP   +       +T  T T  P+ T   +   
Sbjct: 2000 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 2059

Query: 210  TCLNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPA---PPPPEPRTTAAAICWPPP 380
            T +  +     +P      +P   P+    T   T  P     P   P TT   +   P 
Sbjct: 2060 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 2119

Query: 381  PDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPACSACRSWTPAPA 560
            P    +P T+P   +T    + T  T   +PT          TTP    +   + TP P 
Sbjct: 2120 PTGTQTPTTTPITTTTTVTPTPT-PTGTQTPT----------TTP---ITTTTTVTPTPT 2165

Query: 561  PFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSSTWAMSRRWAR 740
            P  +       +TPT TP+    T TPT     T        T  P T++T         
Sbjct: 2166 PTGT-------QTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVTP---TP 2210

Query: 741  LPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPRWASCATWSRTLSW 917
             P  + +  ++P     +  PTP+   T TP+T    ++++ T TP      T + T   
Sbjct: 2211 TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 2270

Query: 918  LSPPARWPPQPSSRPRPPAAPWAACRAWARPSACLCPRSAG---PSWAPATAATCC--PP 1082
             +      P P+    P   P          +    P   G   P+  P T  T     P
Sbjct: 2271 TTTTVTPTPTPTGTQTPTTTP-----ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTP 2325

Query: 1083 SPLSTFTPSSTP 1118
            +P  T TP++TP
Sbjct: 2326 TPTGTQTPTTTP 2337

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 106/425 (24%), Positives = 146/425 (33%), Gaps = 53/425 (12%)
 Frame = +3

Query: 3    PWCASSPPPAPSPWTTPPCT--SPPTSRPSSQRLASLSPPTPARAAACWRASTRCTATSA 176
            P    SPPP  +  T PP T  SPPT+   S  + + + P P             T  S+
Sbjct: 1637 PTTTPSPPPTTT-TTPPPTTTPSPPTTTTPSPPITTTTTPPPT------------TTPSS 1683

Query: 177  PSRT--SPPSTRWTCLNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAPPPPEPRT 350
            P  T  SPP+T  T  +P+    +   +    S    P PPP T    +P   P P P T
Sbjct: 1684 PITTTPSPPTTTMTTPSPTTTPSSPITTTTTPSSTTTPSPPPTTMTTPSPTTTPSP-PTT 1742

Query: 351  TAAAICWPPPPDPACSP-WTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPAC 527
            T   +    PP    SP  T+P PPS               PT    F+P   TTP   C
Sbjct: 1743 TMTTL----PPTTTSSPLTTTPLPPS------------ITPPT----FSPFSTTTPTTPC 1782

Query: 528  SACRSWT-----PAPAPFRSGRRRHTLRT---PTWTP-LMCAATATP----------TRC 650
                +WT       P   + G     +     P W   + C AT  P            C
Sbjct: 1783 VPLCNWTGWLDSGKPNFHKPGGDTELIGDVCGPGWAANISCRATMYPDVPIGQLGQTVVC 1842

Query: 651  RASTWNSCR-----------------------CCATCRPPTSSTWAMSRRWARLPATSPS 761
              S    C+                       CC     PT+ T   +      P T+P 
Sbjct: 1843 DVSVGLICKNEDQKPGGVIPMAFCLNYEINVQCCECVTQPTTMTTTTTEN-PTPPTTTPI 1901

Query: 762  TPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPRWASCATWSRTLSWLSPPARW 938
            T ++      +  PTP+   T TP+T    ++++ T TP      T + T    +     
Sbjct: 1902 TTTT------TVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP 1955

Query: 939  PPQPSSRPRPPAAPWAACRAWARPSACLCPRSAG---PSWAPATAATCC--PPSPLSTFT 1103
             P P+    P   P          +    P   G   P+  P T  T     P+P  T T
Sbjct: 1956 TPTPTGTQTPTTTP-----ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQT 2010

Query: 1104 PSSTP 1118
            P++TP
Sbjct: 2011 PTTTP 2015

 Score = 74.3 bits (181), Expect = 4e-12
 Identities = 98/389 (25%), Positives = 142/389 (36%), Gaps = 28/389 (7%)
 Frame = +3

Query: 36   SPWTTPPCTSPPTSRPSSQRLASLSPPTP--ARAAACWRASTRCTATSAPSRTSPPSTRW 209
            +P  TP  T  PT+ P +        PTP   +       +T  T T  P+ T   +   
Sbjct: 3909 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 3968

Query: 210  TCLNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPA---PPPPEPRTTAAAICWPPP 380
            T +  +     +P      +P   P+    T   T  P     P   P TT   +   P 
Sbjct: 3969 TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 4028

Query: 381  PDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRT-TPPPACSACRSWTP-- 551
            P    +P T+P   +T    + T  T   +PT          T TP P  +   + TP  
Sbjct: 4029 PTGTQTPTTTPITTTTTVTPTPT-PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT 4087

Query: 552  -----APAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSSTW 716
                  P P  +G      +TPT TP+    T TPT     T        T  P T++T 
Sbjct: 4088 TTTTVTPTPTPTG-----TQTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTT 4137

Query: 717  AMSRRWARLPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPRWASCA 893
                     P  + +  ++P     +  PTP+   T TP+T    ++++ T TP      
Sbjct: 4138 VTP---TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ 4194

Query: 894  TWSRTLSWLSPPARW----PPQPSSRP---RPPAAPWAACRAW--ARPSACLCPRSAGPS 1046
            T   T +  +P A      PP  SS P   R  ++P           P A     +A PS
Sbjct: 4195 TGPPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEMTSTAPPS 4254

Query: 1047 --WAPATAA---TCCPPSPLSTFTPSSTP 1118
               AP T +   T  PP P +T +P  TP
Sbjct: 4255 TPTAPTTTSGGHTLSPP-PSTTTSPPGTP 4282

 Score = 73.9 bits (180), Expect = 5e-12
 Identities = 91/376 (24%), Positives = 129/376 (34%), Gaps = 18/376 (4%)
 Frame = +3

Query: 36   SPWTTPPCTSPPTSRPSSQRLASLSPPTPARAAACWRASTRCTATSAPSRTSPPSTRWTC 215
            +P  TP  T  PT+ P +        PTP       +  T    T+  + T  P+   T 
Sbjct: 3978 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT----QTPTTTPITTTTTVTPTPTPTGTQ 4033

Query: 216  LNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAP---------PPPEPRTTAAAIC 368
               + P  T+    P  +P     P       TT   P         P   P TT   + 
Sbjct: 4034 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 4093

Query: 369  WPPPPDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRT-TPPPACSACRSW 545
              P P    +P T+P   +T    + T  T   +PT          T TP P  +   + 
Sbjct: 4094 PTPTPTGTQTPTTTPITTTTTVTPTPT-PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 4152

Query: 546  TP-------APAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPT 704
            TP        P P  +G      +TPT TP+    T TPT     T           PPT
Sbjct: 4153 TPITTTTTVTPTPTPTG-----TQTPTTTPITTTTTVTPTPTPTGTQTG--------PPT 4199

Query: 705  -SSTWAMSRRWARLPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*TTPRW 881
             +ST  ++      P    STP + R   +    + + LST  P      S++  +TP  
Sbjct: 4200 HTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLST-LPPAIEMTSTAPPSTPTA 4258

Query: 882  ASCATWSRTLSWLSPPARWPPQPSSRPRPPAAPWAACRAWARPSACLCPRSAGPSWAPAT 1061
             +  +   TLS         P PS+   PP  P        R +      +  PS    T
Sbjct: 4259 PTTTSGGHTLS---------PPPSTTTSPPGTP-------TRGTTTGSSSAPTPSTVQTT 4302

Query: 1062 AATCCPPSPLSTFTPS 1109
              +   P+P    TPS
Sbjct: 4303 TTSAWTPTPTPLSTPS 4318

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 100/399 (25%), Positives = 140/399 (35%), Gaps = 38/399 (9%)
 Frame = +3

Query: 36   SPWTTPPCTSPPTSRPSSQRLASLSPPTPARAAACWRASTRCTATSAPSRTSPPSTRWTC 215
            +P  TP  T  PT+ P +        PTP       +  T    T+  + T  P+   T 
Sbjct: 3932 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT----QTPTTTPITTTTTVTPTPTPTGTQ 3987

Query: 216  LNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAP---------PPPEPRTTAAAIC 368
               + P  T+    P  +P     P       TT   P         P   P TT   + 
Sbjct: 3988 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 4047

Query: 369  WPPPPDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRT-TPPPACSACRSW 545
              P P    +P T+P   +T    + T  T   +PT          T TP P  +   + 
Sbjct: 4048 PTPTPTGTQTPTTTPITTTTTVTPTPT-PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 4106

Query: 546  TP-------APAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPT 704
            TP        P P  +G      +TPT TP+    T TPT     T        T    T
Sbjct: 4107 TPITTTTTVTPTPTPTG-----TQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT--TTT 4159

Query: 705  SSTWAMSRRWARLPATSPSTPSSPRRCRASRAPTPSALSTGTPS----------TASSP- 851
            + T   +    + P T+P T ++      +  PTP+   TG P+          T S+P 
Sbjct: 4160 TVTPTPTPTGTQTPTTTPITTTT----TVTPTPTPTGTQTGPPTHTSTAPIAELTTSNPP 4215

Query: 852  --SSSS*TTPRWASCATWSRTLSWLSPPA--RWPPQPSSRPRPPAAPWAACRAWARPSAC 1019
              SS+  T+   +S  T S TL    PPA       P S P  P            PS  
Sbjct: 4216 PESSTPQTSRSTSSPLTESTTLLSTLPPAIEMTSTAPPSTPTAPTTTSGGHTLSPPPSTT 4275

Query: 1020 LCPRSAGPSWAPATAATCCP-PSPLST-----FTPSSTP 1118
              P    P+    T ++  P PS + T     +TP+ TP
Sbjct: 4276 TSPPGT-PTRGTTTGSSSAPTPSTVQTTTTSAWTPTPTP 4313

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 89/385 (23%), Positives = 135/385 (34%), Gaps = 20/385 (5%)
 Frame = +3

Query: 24   PPAPSPWTTPPCTSPP-----TSRPSSQRLASLSPPTPARAAACWRASTRCTATSAPSRT 188
            PP  +P TT    +P      T  P++  + + +  TP       +  T    T+  + T
Sbjct: 1895 PPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 1954

Query: 189  SPPSTRWTCLNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAP---------PPPE 341
              P+   T    + P  T+    P  +P     P       TT   P         P   
Sbjct: 1955 PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT 2014

Query: 342  PRTTAAAICWPPPPDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPP 521
            P TT   +   P P    +P T+P   +T    + T  T   +PT          TTP  
Sbjct: 2015 PITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT-PTGTQTPT----------TTP-- 2061

Query: 522  ACSACRSWTPAPAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPP 701
              +   + TP P P  +       +TPT TP+    T TPT     T        T  P 
Sbjct: 2062 -ITTTTTVTPTPTPTGT-------QTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPI 2108

Query: 702  TSSTWAMSRRWARLPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPR 878
            T++T          P  + +  ++P     +  PTP+   T TP+T    ++++ T TP 
Sbjct: 2109 TTTTTVTP---TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT 2165

Query: 879  WASCATWSRTLSWLSPPARWPPQPSSRPRPPAAPWAACRAWARPSACLCPRSAG---PSW 1049
                 T + T    +      P P+    P   P          +    P   G   P+ 
Sbjct: 2166 PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTP-----ITTTTTVTPTPTPTGTQTPTT 2220

Query: 1050 APATAATCC--PPSPLSTFTPSSTP 1118
             P T  T     P+P  T TP++TP
Sbjct: 2221 TPITTTTTVTPTPTPTGTQTPTTTP 2245

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 89/376 (23%), Positives = 131/376 (34%), Gaps = 15/376 (3%)
 Frame = +3

Query: 36   SPWTTPPCTSPPTSRPSSQRLASLSPPTPARAAACWRASTRCTATSAPSRTSPPSTRWTC 215
            +P  TP  T  PT+ P +        PTP       +  T    T+  + T  P+   T 
Sbjct: 2253 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT----QTPTTTPITTTTTVTPTPTPTGTQ 2308

Query: 216  LNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAP---------PPPEPRTTAAAIC 368
               + P  T+    P  +P     P       TT   P         P   P TT   + 
Sbjct: 2309 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 2368

Query: 369  WPPPPDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPACSACRSWT 548
              P P    +P T+P   +T    + T  T   +PT          TTP    +   + T
Sbjct: 2369 PTPTPTGTQTPTTTPITTTTTVTPTPT-PTGTQTPT----------TTP---ITTTTTVT 2414

Query: 549  PAPAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSSTWAMSR 728
            P P P  +       +TPT TP+    T TPT     T        T  P T++T     
Sbjct: 2415 PTPTPTGT-------QTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVTP- 2461

Query: 729  RWARLPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPRWASCATWSR 905
                 P  + +  ++P     +  PTP+   T TP+T    ++++ T TP      T + 
Sbjct: 2462 --TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 2519

Query: 906  TLSWLSPPARWPPQPSSRPRPPAAPWAACRAWARPSACLCPRSAG---PSWAPATAATCC 1076
            T    +      P P+    P   P          +    P   G   P+  P T  T  
Sbjct: 2520 TPITTTTTVTPTPTPTGTQTPTTTP-----ITTTTTVTPTPTPTGTQTPTTTPITTTTTV 2574

Query: 1077 --PPSPLSTFTPSSTP 1118
               P+P  T TP++TP
Sbjct: 2575 TPTPTPTGTQTPTTTP 2590

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 89/376 (23%), Positives = 131/376 (34%), Gaps = 15/376 (3%)
 Frame = +3

Query: 36   SPWTTPPCTSPPTSRPSSQRLASLSPPTPARAAACWRASTRCTATSAPSRTSPPSTRWTC 215
            +P  TP  T  PT+ P +        PTP       +  T    T+  + T  P+   T 
Sbjct: 2552 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT----QTPTTTPITTTTTVTPTPTPTGTQ 2607

Query: 216  LNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAP---------PPPEPRTTAAAIC 368
               + P  T+    P  +P     P       TT   P         P   P TT   + 
Sbjct: 2608 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 2667

Query: 369  WPPPPDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPACSACRSWT 548
              P P    +P T+P   +T    + T  T   +PT          TTP    +   + T
Sbjct: 2668 PTPTPTGTQTPTTTPITTTTTVTPTPT-PTGTQTPT----------TTP---ITTTTTVT 2713

Query: 549  PAPAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSSTWAMSR 728
            P P P  +       +TPT TP+    T TPT     T        T  P T++T     
Sbjct: 2714 PTPTPTGT-------QTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVTP- 2760

Query: 729  RWARLPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPRWASCATWSR 905
                 P  + +  ++P     +  PTP+   T TP+T    ++++ T TP      T + 
Sbjct: 2761 --TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 2818

Query: 906  TLSWLSPPARWPPQPSSRPRPPAAPWAACRAWARPSACLCPRSAG---PSWAPATAATCC 1076
            T    +      P P+    P   P          +    P   G   P+  P T  T  
Sbjct: 2819 TPITTTTTVTPTPTPTGTQTPTTTP-----ITTTTTVTPTPTPTGTQTPTTTPITTTTTV 2873

Query: 1077 --PPSPLSTFTPSSTP 1118
               P+P  T TP++TP
Sbjct: 2874 TPTPTPTGTQTPTTTP 2889

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 89/376 (23%), Positives = 131/376 (34%), Gaps = 15/376 (3%)
 Frame = +3

Query: 36   SPWTTPPCTSPPTSRPSSQRLASLSPPTPARAAACWRASTRCTATSAPSRTSPPSTRWTC 215
            +P  TP  T  PT+ P +        PTP       +  T    T+  + T  P+   T 
Sbjct: 2230 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT----QTPTTTPITTTTTVTPTPTPTGTQ 2285

Query: 216  LNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAP---------PPPEPRTTAAAIC 368
               + P  T+    P  +P     P       TT   P         P   P TT   + 
Sbjct: 2286 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 2345

Query: 369  WPPPPDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPACSACRSWT 548
              P P    +P T+P   +T    + T  T   +PT          TTP    +   + T
Sbjct: 2346 PTPTPTGTQTPTTTPITTTTTVTPTPT-PTGTQTPT----------TTP---ITTTTTVT 2391

Query: 549  PAPAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSSTWAMSR 728
            P P P  +       +TPT TP+    T TPT     T        T  P T++T     
Sbjct: 2392 PTPTPTGT-------QTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVTP- 2438

Query: 729  RWARLPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPRWASCATWSR 905
                 P  + +  ++P     +  PTP+   T TP+T    ++++ T TP      T + 
Sbjct: 2439 --TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 2496

Query: 906  TLSWLSPPARWPPQPSSRPRPPAAPWAACRAWARPSACLCPRSAG---PSWAPATAATCC 1076
            T    +      P P+    P   P          +    P   G   P+  P T  T  
Sbjct: 2497 TPITTTTTVTPTPTPTGTQTPTTTP-----ITTTTTVTPTPTPTGTQTPTTTPITTTTTV 2551

Query: 1077 --PPSPLSTFTPSSTP 1118
               P+P  T TP++TP
Sbjct: 2552 TPTPTPTGTQTPTTTP 2567

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 89/376 (23%), Positives = 131/376 (34%), Gaps = 15/376 (3%)
 Frame = +3

Query: 36   SPWTTPPCTSPPTSRPSSQRLASLSPPTPARAAACWRASTRCTATSAPSRTSPPSTRWTC 215
            +P  TP  T  PT+ P +        PTP       +  T    T+  + T  P+   T 
Sbjct: 2529 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT----QTPTTTPITTTTTVTPTPTPTGTQ 2584

Query: 216  LNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAP---------PPPEPRTTAAAIC 368
               + P  T+    P  +P     P       TT   P         P   P TT   + 
Sbjct: 2585 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 2644

Query: 369  WPPPPDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPACSACRSWT 548
              P P    +P T+P   +T    + T  T   +PT          TTP    +   + T
Sbjct: 2645 PTPTPTGTQTPTTTPITTTTTVTPTPT-PTGTQTPT----------TTP---ITTTTTVT 2690

Query: 549  PAPAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSSTWAMSR 728
            P P P  +       +TPT TP+    T TPT     T        T  P T++T     
Sbjct: 2691 PTPTPTGT-------QTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVTP- 2737

Query: 729  RWARLPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPRWASCATWSR 905
                 P  + +  ++P     +  PTP+   T TP+T    ++++ T TP      T + 
Sbjct: 2738 --TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 2795

Query: 906  TLSWLSPPARWPPQPSSRPRPPAAPWAACRAWARPSACLCPRSAG---PSWAPATAATCC 1076
            T    +      P P+    P   P          +    P   G   P+  P T  T  
Sbjct: 2796 TPITTTTTVTPTPTPTGTQTPTTTP-----ITTTTTVTPTPTPTGTQTPTTTPITTTTTV 2850

Query: 1077 --PPSPLSTFTPSSTP 1118
               P+P  T TP++TP
Sbjct: 2851 TPTPTPTGTQTPTTTP 2866

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 89/376 (23%), Positives = 131/376 (34%), Gaps = 15/376 (3%)
 Frame = +3

Query: 36   SPWTTPPCTSPPTSRPSSQRLASLSPPTPARAAACWRASTRCTATSAPSRTSPPSTRWTC 215
            +P  TP  T  PT+ P +        PTP       +  T    T+  + T  P+   T 
Sbjct: 3104 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT----QTPTTTPITTTTTVTPTPTPTGTQ 3159

Query: 216  LNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAP---------PPPEPRTTAAAIC 368
               + P  T+    P  +P     P       TT   P         P   P TT   + 
Sbjct: 3160 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 3219

Query: 369  WPPPPDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPACSACRSWT 548
              P P    +P T+P   +T    + T  T   +PT          TTP    +   + T
Sbjct: 3220 PTPTPTGTQTPTTTPITTTTTVTPTPT-PTGTQTPT----------TTP---ITTTTTVT 3265

Query: 549  PAPAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSSTWAMSR 728
            P P P  +       +TPT TP+    T TPT     T        T  P T++T     
Sbjct: 3266 PTPTPTGT-------QTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVTP- 3312

Query: 729  RWARLPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPRWASCATWSR 905
                 P  + +  ++P     +  PTP+   T TP+T    ++++ T TP      T + 
Sbjct: 3313 --TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 3370

Query: 906  TLSWLSPPARWPPQPSSRPRPPAAPWAACRAWARPSACLCPRSAG---PSWAPATAATCC 1076
            T    +      P P+    P   P          +    P   G   P+  P T  T  
Sbjct: 3371 TPITTTTTVTPTPTPTGTQTPTTTP-----ITTTTTVTPTPTPTGTQTPTTTPITTTTTV 3425

Query: 1077 --PPSPLSTFTPSSTP 1118
               P+P  T TP++TP
Sbjct: 3426 TPTPTPTGTQTPTTTP 3441

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 89/376 (23%), Positives = 131/376 (34%), Gaps = 15/376 (3%)
 Frame = +3

Query: 36   SPWTTPPCTSPPTSRPSSQRLASLSPPTPARAAACWRASTRCTATSAPSRTSPPSTRWTC 215
            +P  TP  T  PT+ P +        PTP       +  T    T+  + T  P+   T 
Sbjct: 3219 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT----QTPTTTPITTTTTVTPTPTPTGTQ 3274

Query: 216  LNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAP---------PPPEPRTTAAAIC 368
               + P  T+    P  +P     P       TT   P         P   P TT   + 
Sbjct: 3275 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 3334

Query: 369  WPPPPDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPACSACRSWT 548
              P P    +P T+P   +T    + T  T   +PT          TTP    +   + T
Sbjct: 3335 PTPTPTGTQTPTTTPITTTTTVTPTPT-PTGTQTPT----------TTP---ITTTTTVT 3380

Query: 549  PAPAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSSTWAMSR 728
            P P P  +       +TPT TP+    T TPT     T        T  P T++T     
Sbjct: 3381 PTPTPTGT-------QTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVTP- 3427

Query: 729  RWARLPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPRWASCATWSR 905
                 P  + +  ++P     +  PTP+   T TP+T    ++++ T TP      T + 
Sbjct: 3428 --TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 3485

Query: 906  TLSWLSPPARWPPQPSSRPRPPAAPWAACRAWARPSACLCPRSAG---PSWAPATAATCC 1076
            T    +      P P+    P   P          +    P   G   P+  P T  T  
Sbjct: 3486 TPITTTTTVTPTPTPTGTQTPTTTP-----ITTTTTVTPTPTPTGTQTPTTTPITTTTTV 3540

Query: 1077 --PPSPLSTFTPSSTP 1118
               P+P  T TP++TP
Sbjct: 3541 TPTPTPTGTQTPTTTP 3556

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 89/376 (23%), Positives = 131/376 (34%), Gaps = 15/376 (3%)
 Frame = +3

Query: 36   SPWTTPPCTSPPTSRPSSQRLASLSPPTPARAAACWRASTRCTATSAPSRTSPPSTRWTC 215
            +P  TP  T  PT+ P +        PTP       +  T    T+  + T  P+   T 
Sbjct: 3242 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT----QTPTTTPITTTTTVTPTPTPTGTQ 3297

Query: 216  LNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAP---------PPPEPRTTAAAIC 368
               + P  T+    P  +P     P       TT   P         P   P TT   + 
Sbjct: 3298 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 3357

Query: 369  WPPPPDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPACSACRSWT 548
              P P    +P T+P   +T    + T  T   +PT          TTP    +   + T
Sbjct: 3358 PTPTPTGTQTPTTTPITTTTTVTPTPT-PTGTQTPT----------TTP---ITTTTTVT 3403

Query: 549  PAPAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSSTWAMSR 728
            P P P  +       +TPT TP+    T TPT     T        T  P T++T     
Sbjct: 3404 PTPTPTGT-------QTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVTP- 3450

Query: 729  RWARLPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPRWASCATWSR 905
                 P  + +  ++P     +  PTP+   T TP+T    ++++ T TP      T + 
Sbjct: 3451 --TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 3508

Query: 906  TLSWLSPPARWPPQPSSRPRPPAAPWAACRAWARPSACLCPRSAG---PSWAPATAATCC 1076
            T    +      P P+    P   P          +    P   G   P+  P T  T  
Sbjct: 3509 TPITTTTTVTPTPTPTGTQTPTTTP-----ITTTTTVTPTPTPTGTQTPTTTPITTTTTV 3563

Query: 1077 --PPSPLSTFTPSSTP 1118
               P+P  T TP++TP
Sbjct: 3564 TPTPTPTGTQTPTTTP 3579

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 89/376 (23%), Positives = 131/376 (34%), Gaps = 15/376 (3%)
 Frame = +3

Query: 36   SPWTTPPCTSPPTSRPSSQRLASLSPPTPARAAACWRASTRCTATSAPSRTSPPSTRWTC 215
            +P  TP  T  PT+ P +        PTP       +  T    T+  + T  P+   T 
Sbjct: 2598 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT----QTPTTTPITTTTTVTPTPTPTGTQ 2653

Query: 216  LNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAP---------PPPEPRTTAAAIC 368
               + P  T+    P  +P     P       TT   P         P   P TT   + 
Sbjct: 2654 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 2713

Query: 369  WPPPPDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPACSACRSWT 548
              P P    +P T+P   +T    + T  T   +PT          TTP    +   + T
Sbjct: 2714 PTPTPTGTQTPTTTPITTTTTVTPTPT-PTGTQTPT----------TTP---ITTTTTVT 2759

Query: 549  PAPAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSSTWAMSR 728
            P P P  +       +TPT TP+    T TPT     T        T  P T++T     
Sbjct: 2760 PTPTPTGT-------QTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVTP- 2806

Query: 729  RWARLPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPRWASCATWSR 905
                 P  + +  ++P     +  PTP+   T TP+T    ++++ T TP      T + 
Sbjct: 2807 --TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 2864

Query: 906  TLSWLSPPARWPPQPSSRPRPPAAPWAACRAWARPSACLCPRSAG---PSWAPATAATCC 1076
            T    +      P P+    P   P          +    P   G   P+  P T  T  
Sbjct: 2865 TPITTTTTVTPTPTPTGTQTPTTTP-----ITTTTTVTPTPTPTGTQTPTTTPITTTTTV 2919

Query: 1077 --PPSPLSTFTPSSTP 1118
               P+P  T TP++TP
Sbjct: 2920 TPTPTPTGTQTPTTTP 2935

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 89/376 (23%), Positives = 131/376 (34%), Gaps = 15/376 (3%)
 Frame = +3

Query: 36   SPWTTPPCTSPPTSRPSSQRLASLSPPTPARAAACWRASTRCTATSAPSRTSPPSTRWTC 215
            +P  TP  T  PT+ P +        PTP       +  T    T+  + T  P+   T 
Sbjct: 2621 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT----QTPTTTPITTTTTVTPTPTPTGTQ 2676

Query: 216  LNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAP---------PPPEPRTTAAAIC 368
               + P  T+    P  +P     P       TT   P         P   P TT   + 
Sbjct: 2677 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 2736

Query: 369  WPPPPDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPACSACRSWT 548
              P P    +P T+P   +T    + T  T   +PT          TTP    +   + T
Sbjct: 2737 PTPTPTGTQTPTTTPITTTTTVTPTPT-PTGTQTPT----------TTP---ITTTTTVT 2782

Query: 549  PAPAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSSTWAMSR 728
            P P P  +       +TPT TP+    T TPT     T        T  P T++T     
Sbjct: 2783 PTPTPTGT-------QTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVTP- 2829

Query: 729  RWARLPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPRWASCATWSR 905
                 P  + +  ++P     +  PTP+   T TP+T    ++++ T TP      T + 
Sbjct: 2830 --TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 2887

Query: 906  TLSWLSPPARWPPQPSSRPRPPAAPWAACRAWARPSACLCPRSAG---PSWAPATAATCC 1076
            T    +      P P+    P   P          +    P   G   P+  P T  T  
Sbjct: 2888 TPITTTTTVTPTPTPTGTQTPTTTP-----ITTTTTVTPTPTPTGTQTPTTTPITTTTTV 2942

Query: 1077 --PPSPLSTFTPSSTP 1118
               P+P  T TP++TP
Sbjct: 2943 TPTPTPTGTQTPTTTP 2958

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 89/376 (23%), Positives = 131/376 (34%), Gaps = 15/376 (3%)
 Frame = +3

Query: 36   SPWTTPPCTSPPTSRPSSQRLASLSPPTPARAAACWRASTRCTATSAPSRTSPPSTRWTC 215
            +P  TP  T  PT+ P +        PTP       +  T    T+  + T  P+   T 
Sbjct: 2506 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT----QTPTTTPITTTTTVTPTPTPTGTQ 2561

Query: 216  LNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAP---------PPPEPRTTAAAIC 368
               + P  T+    P  +P     P       TT   P         P   P TT   + 
Sbjct: 2562 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 2621

Query: 369  WPPPPDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPACSACRSWT 548
              P P    +P T+P   +T    + T  T   +PT          TTP    +   + T
Sbjct: 2622 PTPTPTGTQTPTTTPITTTTTVTPTPT-PTGTQTPT----------TTP---ITTTTTVT 2667

Query: 549  PAPAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSSTWAMSR 728
            P P P  +       +TPT TP+    T TPT     T        T  P T++T     
Sbjct: 2668 PTPTPTGT-------QTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVTP- 2714

Query: 729  RWARLPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPRWASCATWSR 905
                 P  + +  ++P     +  PTP+   T TP+T    ++++ T TP      T + 
Sbjct: 2715 --TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 2772

Query: 906  TLSWLSPPARWPPQPSSRPRPPAAPWAACRAWARPSACLCPRSAG---PSWAPATAATCC 1076
            T    +      P P+    P   P          +    P   G   P+  P T  T  
Sbjct: 2773 TPITTTTTVTPTPTPTGTQTPTTTP-----ITTTTTVTPTPTPTGTQTPTTTPITTTTTV 2827

Query: 1077 --PPSPLSTFTPSSTP 1118
               P+P  T TP++TP
Sbjct: 2828 TPTPTPTGTQTPTTTP 2843

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 89/376 (23%), Positives = 131/376 (34%), Gaps = 15/376 (3%)
 Frame = +3

Query: 36   SPWTTPPCTSPPTSRPSSQRLASLSPPTPARAAACWRASTRCTATSAPSRTSPPSTRWTC 215
            +P  TP  T  PT+ P +        PTP       +  T    T+  + T  P+   T 
Sbjct: 2483 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT----QTPTTTPITTTTTVTPTPTPTGTQ 2538

Query: 216  LNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAP---------PPPEPRTTAAAIC 368
               + P  T+    P  +P     P       TT   P         P   P TT   + 
Sbjct: 2539 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 2598

Query: 369  WPPPPDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPACSACRSWT 548
              P P    +P T+P   +T    + T  T   +PT          TTP    +   + T
Sbjct: 2599 PTPTPTGTQTPTTTPITTTTTVTPTPT-PTGTQTPT----------TTP---ITTTTTVT 2644

Query: 549  PAPAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSSTWAMSR 728
            P P P  +       +TPT TP+    T TPT     T        T  P T++T     
Sbjct: 2645 PTPTPTGT-------QTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVTP- 2691

Query: 729  RWARLPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPRWASCATWSR 905
                 P  + +  ++P     +  PTP+   T TP+T    ++++ T TP      T + 
Sbjct: 2692 --TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 2749

Query: 906  TLSWLSPPARWPPQPSSRPRPPAAPWAACRAWARPSACLCPRSAG---PSWAPATAATCC 1076
            T    +      P P+    P   P          +    P   G   P+  P T  T  
Sbjct: 2750 TPITTTTTVTPTPTPTGTQTPTTTP-----ITTTTTVTPTPTPTGTQTPTTTPITTTTTV 2804

Query: 1077 --PPSPLSTFTPSSTP 1118
               P+P  T TP++TP
Sbjct: 2805 TPTPTPTGTQTPTTTP 2820

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 89/376 (23%), Positives = 131/376 (34%), Gaps = 15/376 (3%)
 Frame = +3

Query: 36   SPWTTPPCTSPPTSRPSSQRLASLSPPTPARAAACWRASTRCTATSAPSRTSPPSTRWTC 215
            +P  TP  T  PT+ P +        PTP       +  T    T+  + T  P+   T 
Sbjct: 3035 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT----QTPTTTPITTTTTVTPTPTPTGTQ 3090

Query: 216  LNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAP---------PPPEPRTTAAAIC 368
               + P  T+    P  +P     P       TT   P         P   P TT   + 
Sbjct: 3091 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 3150

Query: 369  WPPPPDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPACSACRSWT 548
              P P    +P T+P   +T    + T  T   +PT          TTP    +   + T
Sbjct: 3151 PTPTPTGTQTPTTTPITTTTTVTPTPT-PTGTQTPT----------TTP---ITTTTTVT 3196

Query: 549  PAPAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSSTWAMSR 728
            P P P  +       +TPT TP+    T TPT     T        T  P T++T     
Sbjct: 3197 PTPTPTGT-------QTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVTP- 3243

Query: 729  RWARLPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPRWASCATWSR 905
                 P  + +  ++P     +  PTP+   T TP+T    ++++ T TP      T + 
Sbjct: 3244 --TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 3301

Query: 906  TLSWLSPPARWPPQPSSRPRPPAAPWAACRAWARPSACLCPRSAG---PSWAPATAATCC 1076
            T    +      P P+    P   P          +    P   G   P+  P T  T  
Sbjct: 3302 TPITTTTTVTPTPTPTGTQTPTTTP-----ITTTTTVTPTPTPTGTQTPTTTPITTTTTV 3356

Query: 1077 --PPSPLSTFTPSSTP 1118
               P+P  T TP++TP
Sbjct: 3357 TPTPTPTGTQTPTTTP 3372

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 89/376 (23%), Positives = 131/376 (34%), Gaps = 15/376 (3%)
 Frame = +3

Query: 36   SPWTTPPCTSPPTSRPSSQRLASLSPPTPARAAACWRASTRCTATSAPSRTSPPSTRWTC 215
            +P  TP  T  PT+ P +        PTP       +  T    T+  + T  P+   T 
Sbjct: 3012 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT----QTPTTTPITTTTTVTPTPTPTGTQ 3067

Query: 216  LNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAP---------PPPEPRTTAAAIC 368
               + P  T+    P  +P     P       TT   P         P   P TT   + 
Sbjct: 3068 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 3127

Query: 369  WPPPPDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPACSACRSWT 548
              P P    +P T+P   +T    + T  T   +PT          TTP    +   + T
Sbjct: 3128 PTPTPTGTQTPTTTPITTTTTVTPTPT-PTGTQTPT----------TTP---ITTTTTVT 3173

Query: 549  PAPAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSSTWAMSR 728
            P P P  +       +TPT TP+    T TPT     T        T  P T++T     
Sbjct: 3174 PTPTPTGT-------QTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVTP- 3220

Query: 729  RWARLPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPRWASCATWSR 905
                 P  + +  ++P     +  PTP+   T TP+T    ++++ T TP      T + 
Sbjct: 3221 --TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 3278

Query: 906  TLSWLSPPARWPPQPSSRPRPPAAPWAACRAWARPSACLCPRSAG---PSWAPATAATCC 1076
            T    +      P P+    P   P          +    P   G   P+  P T  T  
Sbjct: 3279 TPITTTTTVTPTPTPTGTQTPTTTP-----ITTTTTVTPTPTPTGTQTPTTTPITTTTTV 3333

Query: 1077 --PPSPLSTFTPSSTP 1118
               P+P  T TP++TP
Sbjct: 3334 TPTPTPTGTQTPTTTP 3349

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 89/376 (23%), Positives = 131/376 (34%), Gaps = 15/376 (3%)
 Frame = +3

Query: 36   SPWTTPPCTSPPTSRPSSQRLASLSPPTPARAAACWRASTRCTATSAPSRTSPPSTRWTC 215
            +P  TP  T  PT+ P +        PTP       +  T    T+  + T  P+   T 
Sbjct: 2184 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT----QTPTTTPITTTTTVTPTPTPTGTQ 2239

Query: 216  LNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAP---------PPPEPRTTAAAIC 368
               + P  T+    P  +P     P       TT   P         P   P TT   + 
Sbjct: 2240 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 2299

Query: 369  WPPPPDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPACSACRSWT 548
              P P    +P T+P   +T    + T  T   +PT          TTP    +   + T
Sbjct: 2300 PTPTPTGTQTPTTTPITTTTTVTPTPT-PTGTQTPT----------TTP---ITTTTTVT 2345

Query: 549  PAPAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSSTWAMSR 728
            P P P  +       +TPT TP+    T TPT     T        T  P T++T     
Sbjct: 2346 PTPTPTGT-------QTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVTP- 2392

Query: 729  RWARLPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPRWASCATWSR 905
                 P  + +  ++P     +  PTP+   T TP+T    ++++ T TP      T + 
Sbjct: 2393 --TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 2450

Query: 906  TLSWLSPPARWPPQPSSRPRPPAAPWAACRAWARPSACLCPRSAG---PSWAPATAATCC 1076
            T    +      P P+    P   P          +    P   G   P+  P T  T  
Sbjct: 2451 TPITTTTTVTPTPTPTGTQTPTTTP-----ITTTTTVTPTPTPTGTQTPTTTPITTTTTV 2505

Query: 1077 --PPSPLSTFTPSSTP 1118
               P+P  T TP++TP
Sbjct: 2506 TPTPTPTGTQTPTTTP 2521

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 89/376 (23%), Positives = 131/376 (34%), Gaps = 15/376 (3%)
 Frame = +3

Query: 36   SPWTTPPCTSPPTSRPSSQRLASLSPPTPARAAACWRASTRCTATSAPSRTSPPSTRWTC 215
            +P  TP  T  PT+ P +        PTP       +  T    T+  + T  P+   T 
Sbjct: 2437 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT----QTPTTTPITTTTTVTPTPTPTGTQ 2492

Query: 216  LNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAP---------PPPEPRTTAAAIC 368
               + P  T+    P  +P     P       TT   P         P   P TT   + 
Sbjct: 2493 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 2552

Query: 369  WPPPPDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPACSACRSWT 548
              P P    +P T+P   +T    + T  T   +PT          TTP    +   + T
Sbjct: 2553 PTPTPTGTQTPTTTPITTTTTVTPTPT-PTGTQTPT----------TTP---ITTTTTVT 2598

Query: 549  PAPAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSSTWAMSR 728
            P P P  +       +TPT TP+    T TPT     T        T  P T++T     
Sbjct: 2599 PTPTPTGT-------QTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVTP- 2645

Query: 729  RWARLPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPRWASCATWSR 905
                 P  + +  ++P     +  PTP+   T TP+T    ++++ T TP      T + 
Sbjct: 2646 --TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 2703

Query: 906  TLSWLSPPARWPPQPSSRPRPPAAPWAACRAWARPSACLCPRSAG---PSWAPATAATCC 1076
            T    +      P P+    P   P          +    P   G   P+  P T  T  
Sbjct: 2704 TPITTTTTVTPTPTPTGTQTPTTTP-----ITTTTTVTPTPTPTGTQTPTTTPITTTTTV 2758

Query: 1077 --PPSPLSTFTPSSTP 1118
               P+P  T TP++TP
Sbjct: 2759 TPTPTPTGTQTPTTTP 2774

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 89/376 (23%), Positives = 131/376 (34%), Gaps = 15/376 (3%)
 Frame = +3

Query: 36   SPWTTPPCTSPPTSRPSSQRLASLSPPTPARAAACWRASTRCTATSAPSRTSPPSTRWTC 215
            +P  TP  T  PT+ P +        PTP       +  T    T+  + T  P+   T 
Sbjct: 2414 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT----QTPTTTPITTTTTVTPTPTPTGTQ 2469

Query: 216  LNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAP---------PPPEPRTTAAAIC 368
               + P  T+    P  +P     P       TT   P         P   P TT   + 
Sbjct: 2470 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 2529

Query: 369  WPPPPDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPACSACRSWT 548
              P P    +P T+P   +T    + T  T   +PT          TTP    +   + T
Sbjct: 2530 PTPTPTGTQTPTTTPITTTTTVTPTPT-PTGTQTPT----------TTP---ITTTTTVT 2575

Query: 549  PAPAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSSTWAMSR 728
            P P P  +       +TPT TP+    T TPT     T        T  P T++T     
Sbjct: 2576 PTPTPTGT-------QTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVTP- 2622

Query: 729  RWARLPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPRWASCATWSR 905
                 P  + +  ++P     +  PTP+   T TP+T    ++++ T TP      T + 
Sbjct: 2623 --TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 2680

Query: 906  TLSWLSPPARWPPQPSSRPRPPAAPWAACRAWARPSACLCPRSAG---PSWAPATAATCC 1076
            T    +      P P+    P   P          +    P   G   P+  P T  T  
Sbjct: 2681 TPITTTTTVTPTPTPTGTQTPTTTP-----ITTTTTVTPTPTPTGTQTPTTTPITTTTTV 2735

Query: 1077 --PPSPLSTFTPSSTP 1118
               P+P  T TP++TP
Sbjct: 2736 TPTPTPTGTQTPTTTP 2751

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 89/376 (23%), Positives = 131/376 (34%), Gaps = 15/376 (3%)
 Frame = +3

Query: 36   SPWTTPPCTSPPTSRPSSQRLASLSPPTPARAAACWRASTRCTATSAPSRTSPPSTRWTC 215
            +P  TP  T  PT+ P +        PTP       +  T    T+  + T  P+   T 
Sbjct: 2161 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT----QTPTTTPITTTTTVTPTPTPTGTQ 2216

Query: 216  LNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAP---------PPPEPRTTAAAIC 368
               + P  T+    P  +P     P       TT   P         P   P TT   + 
Sbjct: 2217 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 2276

Query: 369  WPPPPDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPACSACRSWT 548
              P P    +P T+P   +T    + T  T   +PT          TTP    +   + T
Sbjct: 2277 PTPTPTGTQTPTTTPITTTTTVTPTPT-PTGTQTPT----------TTP---ITTTTTVT 2322

Query: 549  PAPAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSSTWAMSR 728
            P P P  +       +TPT TP+    T TPT     T        T  P T++T     
Sbjct: 2323 PTPTPTGT-------QTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVTP- 2369

Query: 729  RWARLPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPRWASCATWSR 905
                 P  + +  ++P     +  PTP+   T TP+T    ++++ T TP      T + 
Sbjct: 2370 --TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 2427

Query: 906  TLSWLSPPARWPPQPSSRPRPPAAPWAACRAWARPSACLCPRSAG---PSWAPATAATCC 1076
            T    +      P P+    P   P          +    P   G   P+  P T  T  
Sbjct: 2428 TPITTTTTVTPTPTPTGTQTPTTTP-----ITTTTTVTPTPTPTGTQTPTTTPITTTTTV 2482

Query: 1077 --PPSPLSTFTPSSTP 1118
               P+P  T TP++TP
Sbjct: 2483 TPTPTPTGTQTPTTTP 2498

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 89/376 (23%), Positives = 131/376 (34%), Gaps = 15/376 (3%)
 Frame = +3

Query: 36   SPWTTPPCTSPPTSRPSSQRLASLSPPTPARAAACWRASTRCTATSAPSRTSPPSTRWTC 215
            +P  TP  T  PT+ P +        PTP       +  T    T+  + T  P+   T 
Sbjct: 2138 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT----QTPTTTPITTTTTVTPTPTPTGTQ 2193

Query: 216  LNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAP---------PPPEPRTTAAAIC 368
               + P  T+    P  +P     P       TT   P         P   P TT   + 
Sbjct: 2194 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 2253

Query: 369  WPPPPDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPACSACRSWT 548
              P P    +P T+P   +T    + T  T   +PT          TTP    +   + T
Sbjct: 2254 PTPTPTGTQTPTTTPITTTTTVTPTPT-PTGTQTPT----------TTP---ITTTTTVT 2299

Query: 549  PAPAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSSTWAMSR 728
            P P P  +       +TPT TP+    T TPT     T        T  P T++T     
Sbjct: 2300 PTPTPTGT-------QTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVTP- 2346

Query: 729  RWARLPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPRWASCATWSR 905
                 P  + +  ++P     +  PTP+   T TP+T    ++++ T TP      T + 
Sbjct: 2347 --TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 2404

Query: 906  TLSWLSPPARWPPQPSSRPRPPAAPWAACRAWARPSACLCPRSAG---PSWAPATAATCC 1076
            T    +      P P+    P   P          +    P   G   P+  P T  T  
Sbjct: 2405 TPITTTTTVTPTPTPTGTQTPTTTP-----ITTTTTVTPTPTPTGTQTPTTTPITTTTTV 2459

Query: 1077 --PPSPLSTFTPSSTP 1118
               P+P  T TP++TP
Sbjct: 2460 TPTPTPTGTQTPTTTP 2475

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 89/376 (23%), Positives = 131/376 (34%), Gaps = 15/376 (3%)
 Frame = +3

Query: 36   SPWTTPPCTSPPTSRPSSQRLASLSPPTPARAAACWRASTRCTATSAPSRTSPPSTRWTC 215
            +P  TP  T  PT+ P +        PTP       +  T    T+  + T  P+   T 
Sbjct: 3840 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT----QTPTTTPITTTTTVTPTPTPTGTQ 3895

Query: 216  LNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAP---------PPPEPRTTAAAIC 368
               + P  T+    P  +P     P       TT   P         P   P TT   + 
Sbjct: 3896 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 3955

Query: 369  WPPPPDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPACSACRSWT 548
              P P    +P T+P   +T    + T  T   +PT          TTP    +   + T
Sbjct: 3956 PTPTPTGTQTPTTTPITTTTTVTPTPT-PTGTQTPT----------TTP---ITTTTTVT 4001

Query: 549  PAPAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSSTWAMSR 728
            P P P  +       +TPT TP+    T TPT     T        T  P T++T     
Sbjct: 4002 PTPTPTGT-------QTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVTP- 4048

Query: 729  RWARLPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPRWASCATWSR 905
                 P  + +  ++P     +  PTP+   T TP+T    ++++ T TP      T + 
Sbjct: 4049 --TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 4106

Query: 906  TLSWLSPPARWPPQPSSRPRPPAAPWAACRAWARPSACLCPRSAG---PSWAPATAATCC 1076
            T    +      P P+    P   P          +    P   G   P+  P T  T  
Sbjct: 4107 TPITTTTTVTPTPTPTGTQTPTTTP-----ITTTTTVTPTPTPTGTQTPTTTPITTTTTV 4161

Query: 1077 --PPSPLSTFTPSSTP 1118
               P+P  T TP++TP
Sbjct: 4162 TPTPTPTGTQTPTTTP 4177

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 89/376 (23%), Positives = 131/376 (34%), Gaps = 15/376 (3%)
 Frame = +3

Query: 36   SPWTTPPCTSPPTSRPSSQRLASLSPPTPARAAACWRASTRCTATSAPSRTSPPSTRWTC 215
            +P  TP  T  PT+ P +        PTP       +  T    T+  + T  P+   T 
Sbjct: 2391 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT----QTPTTTPITTTTTVTPTPTPTGTQ 2446

Query: 216  LNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAP---------PPPEPRTTAAAIC 368
               + P  T+    P  +P     P       TT   P         P   P TT   + 
Sbjct: 2447 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 2506

Query: 369  WPPPPDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPACSACRSWT 548
              P P    +P T+P   +T    + T  T   +PT          TTP    +   + T
Sbjct: 2507 PTPTPTGTQTPTTTPITTTTTVTPTPT-PTGTQTPT----------TTP---ITTTTTVT 2552

Query: 549  PAPAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSSTWAMSR 728
            P P P  +       +TPT TP+    T TPT     T        T  P T++T     
Sbjct: 2553 PTPTPTGT-------QTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVTP- 2599

Query: 729  RWARLPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPRWASCATWSR 905
                 P  + +  ++P     +  PTP+   T TP+T    ++++ T TP      T + 
Sbjct: 2600 --TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 2657

Query: 906  TLSWLSPPARWPPQPSSRPRPPAAPWAACRAWARPSACLCPRSAG---PSWAPATAATCC 1076
            T    +      P P+    P   P          +    P   G   P+  P T  T  
Sbjct: 2658 TPITTTTTVTPTPTPTGTQTPTTTP-----ITTTTTVTPTPTPTGTQTPTTTPITTTTTV 2712

Query: 1077 --PPSPLSTFTPSSTP 1118
               P+P  T TP++TP
Sbjct: 2713 TPTPTPTGTQTPTTTP 2728

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 89/376 (23%), Positives = 131/376 (34%), Gaps = 15/376 (3%)
 Frame = +3

Query: 36   SPWTTPPCTSPPTSRPSSQRLASLSPPTPARAAACWRASTRCTATSAPSRTSPPSTRWTC 215
            +P  TP  T  PT+ P +        PTP       +  T    T+  + T  P+   T 
Sbjct: 2851 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT----QTPTTTPITTTTTVTPTPTPTGTQ 2906

Query: 216  LNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAP---------PPPEPRTTAAAIC 368
               + P  T+    P  +P     P       TT   P         P   P TT   + 
Sbjct: 2907 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 2966

Query: 369  WPPPPDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPACSACRSWT 548
              P P    +P T+P   +T    + T  T   +PT          TTP    +   + T
Sbjct: 2967 PTPTPTGTQTPTTTPITTTTTVTPTPT-PTGTQTPT----------TTP---ITTTTTVT 3012

Query: 549  PAPAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSSTWAMSR 728
            P P P  +       +TPT TP+    T TPT     T        T  P T++T     
Sbjct: 3013 PTPTPTGT-------QTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVTP- 3059

Query: 729  RWARLPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPRWASCATWSR 905
                 P  + +  ++P     +  PTP+   T TP+T    ++++ T TP      T + 
Sbjct: 3060 --TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 3117

Query: 906  TLSWLSPPARWPPQPSSRPRPPAAPWAACRAWARPSACLCPRSAG---PSWAPATAATCC 1076
            T    +      P P+    P   P          +    P   G   P+  P T  T  
Sbjct: 3118 TPITTTTTVTPTPTPTGTQTPTTTP-----ITTTTTVTPTPTPTGTQTPTTTPITTTTTV 3172

Query: 1077 --PPSPLSTFTPSSTP 1118
               P+P  T TP++TP
Sbjct: 3173 TPTPTPTGTQTPTTTP 3188

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 89/376 (23%), Positives = 131/376 (34%), Gaps = 15/376 (3%)
 Frame = +3

Query: 36   SPWTTPPCTSPPTSRPSSQRLASLSPPTPARAAACWRASTRCTATSAPSRTSPPSTRWTC 215
            +P  TP  T  PT+ P +        PTP       +  T    T+  + T  P+   T 
Sbjct: 3771 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT----QTPTTTPITTTTTVTPTPTPTGTQ 3826

Query: 216  LNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAP---------PPPEPRTTAAAIC 368
               + P  T+    P  +P     P       TT   P         P   P TT   + 
Sbjct: 3827 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 3886

Query: 369  WPPPPDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPACSACRSWT 548
              P P    +P T+P   +T    + T  T   +PT          TTP    +   + T
Sbjct: 3887 PTPTPTGTQTPTTTPITTTTTVTPTPT-PTGTQTPT----------TTP---ITTTTTVT 3932

Query: 549  PAPAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSSTWAMSR 728
            P P P  +       +TPT TP+    T TPT     T        T  P T++T     
Sbjct: 3933 PTPTPTGT-------QTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVTP- 3979

Query: 729  RWARLPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPRWASCATWSR 905
                 P  + +  ++P     +  PTP+   T TP+T    ++++ T TP      T + 
Sbjct: 3980 --TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 4037

Query: 906  TLSWLSPPARWPPQPSSRPRPPAAPWAACRAWARPSACLCPRSAG---PSWAPATAATCC 1076
            T    +      P P+    P   P          +    P   G   P+  P T  T  
Sbjct: 4038 TPITTTTTVTPTPTPTGTQTPTTTP-----ITTTTTVTPTPTPTGTQTPTTTPITTTTTV 4092

Query: 1077 --PPSPLSTFTPSSTP 1118
               P+P  T TP++TP
Sbjct: 4093 TPTPTPTGTQTPTTTP 4108

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 89/376 (23%), Positives = 131/376 (34%), Gaps = 15/376 (3%)
 Frame = +3

Query: 36   SPWTTPPCTSPPTSRPSSQRLASLSPPTPARAAACWRASTRCTATSAPSRTSPPSTRWTC 215
            +P  TP  T  PT+ P +        PTP       +  T    T+  + T  P+   T 
Sbjct: 2943 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT----QTPTTTPITTTTTVTPTPTPTGTQ 2998

Query: 216  LNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAP---------PPPEPRTTAAAIC 368
               + P  T+    P  +P     P       TT   P         P   P TT   + 
Sbjct: 2999 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 3058

Query: 369  WPPPPDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPACSACRSWT 548
              P P    +P T+P   +T    + T  T   +PT          TTP    +   + T
Sbjct: 3059 PTPTPTGTQTPTTTPITTTTTVTPTPT-PTGTQTPT----------TTP---ITTTTTVT 3104

Query: 549  PAPAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSSTWAMSR 728
            P P P  +       +TPT TP+    T TPT     T        T  P T++T     
Sbjct: 3105 PTPTPTGT-------QTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVTP- 3151

Query: 729  RWARLPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPRWASCATWSR 905
                 P  + +  ++P     +  PTP+   T TP+T    ++++ T TP      T + 
Sbjct: 3152 --TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 3209

Query: 906  TLSWLSPPARWPPQPSSRPRPPAAPWAACRAWARPSACLCPRSAG---PSWAPATAATCC 1076
            T    +      P P+    P   P          +    P   G   P+  P T  T  
Sbjct: 3210 TPITTTTTVTPTPTPTGTQTPTTTP-----ITTTTTVTPTPTPTGTQTPTTTPITTTTTV 3264

Query: 1077 --PPSPLSTFTPSSTP 1118
               P+P  T TP++TP
Sbjct: 3265 TPTPTPTGTQTPTTTP 3280

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 89/376 (23%), Positives = 131/376 (34%), Gaps = 15/376 (3%)
 Frame = +3

Query: 36   SPWTTPPCTSPPTSRPSSQRLASLSPPTPARAAACWRASTRCTATSAPSRTSPPSTRWTC 215
            +P  TP  T  PT+ P +        PTP       +  T    T+  + T  P+   T 
Sbjct: 2966 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT----QTPTTTPITTTTTVTPTPTPTGTQ 3021

Query: 216  LNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAP---------PPPEPRTTAAAIC 368
               + P  T+    P  +P     P       TT   P         P   P TT   + 
Sbjct: 3022 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 3081

Query: 369  WPPPPDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPACSACRSWT 548
              P P    +P T+P   +T    + T  T   +PT          TTP    +   + T
Sbjct: 3082 PTPTPTGTQTPTTTPITTTTTVTPTPT-PTGTQTPT----------TTP---ITTTTTVT 3127

Query: 549  PAPAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSSTWAMSR 728
            P P P  +       +TPT TP+    T TPT     T        T  P T++T     
Sbjct: 3128 PTPTPTGT-------QTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVTP- 3174

Query: 729  RWARLPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPRWASCATWSR 905
                 P  + +  ++P     +  PTP+   T TP+T    ++++ T TP      T + 
Sbjct: 3175 --TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 3232

Query: 906  TLSWLSPPARWPPQPSSRPRPPAAPWAACRAWARPSACLCPRSAG---PSWAPATAATCC 1076
            T    +      P P+    P   P          +    P   G   P+  P T  T  
Sbjct: 3233 TPITTTTTVTPTPTPTGTQTPTTTP-----ITTTTTVTPTPTPTGTQTPTTTPITTTTTV 3287

Query: 1077 --PPSPLSTFTPSSTP 1118
               P+P  T TP++TP
Sbjct: 3288 TPTPTPTGTQTPTTTP 3303

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 89/376 (23%), Positives = 131/376 (34%), Gaps = 15/376 (3%)
 Frame = +3

Query: 36   SPWTTPPCTSPPTSRPSSQRLASLSPPTPARAAACWRASTRCTATSAPSRTSPPSTRWTC 215
            +P  TP  T  PT+ P +        PTP       +  T    T+  + T  P+   T 
Sbjct: 2989 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT----QTPTTTPITTTTTVTPTPTPTGTQ 3044

Query: 216  LNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAP---------PPPEPRTTAAAIC 368
               + P  T+    P  +P     P       TT   P         P   P TT   + 
Sbjct: 3045 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 3104

Query: 369  WPPPPDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPACSACRSWT 548
              P P    +P T+P   +T    + T  T   +PT          TTP    +   + T
Sbjct: 3105 PTPTPTGTQTPTTTPITTTTTVTPTPT-PTGTQTPT----------TTP---ITTTTTVT 3150

Query: 549  PAPAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSSTWAMSR 728
            P P P  +       +TPT TP+    T TPT     T        T  P T++T     
Sbjct: 3151 PTPTPTGT-------QTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVTP- 3197

Query: 729  RWARLPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPRWASCATWSR 905
                 P  + +  ++P     +  PTP+   T TP+T    ++++ T TP      T + 
Sbjct: 3198 --TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 3255

Query: 906  TLSWLSPPARWPPQPSSRPRPPAAPWAACRAWARPSACLCPRSAG---PSWAPATAATCC 1076
            T    +      P P+    P   P          +    P   G   P+  P T  T  
Sbjct: 3256 TPITTTTTVTPTPTPTGTQTPTTTP-----ITTTTTVTPTPTPTGTQTPTTTPITTTTTV 3310

Query: 1077 --PPSPLSTFTPSSTP 1118
               P+P  T TP++TP
Sbjct: 3311 TPTPTPTGTQTPTTTP 3326

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 89/376 (23%), Positives = 131/376 (34%), Gaps = 15/376 (3%)
 Frame = +3

Query: 36   SPWTTPPCTSPPTSRPSSQRLASLSPPTPARAAACWRASTRCTATSAPSRTSPPSTRWTC 215
            +P  TP  T  PT+ P +        PTP       +  T    T+  + T  P+   T 
Sbjct: 3748 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT----QTPTTTPITTTTTVTPTPTPTGTQ 3803

Query: 216  LNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAP---------PPPEPRTTAAAIC 368
               + P  T+    P  +P     P       TT   P         P   P TT   + 
Sbjct: 3804 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 3863

Query: 369  WPPPPDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPACSACRSWT 548
              P P    +P T+P   +T    + T  T   +PT          TTP    +   + T
Sbjct: 3864 PTPTPTGTQTPTTTPITTTTTVTPTPT-PTGTQTPT----------TTP---ITTTTTVT 3909

Query: 549  PAPAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSSTWAMSR 728
            P P P  +       +TPT TP+    T TPT     T        T  P T++T     
Sbjct: 3910 PTPTPTGT-------QTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVTP- 3956

Query: 729  RWARLPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPRWASCATWSR 905
                 P  + +  ++P     +  PTP+   T TP+T    ++++ T TP      T + 
Sbjct: 3957 --TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 4014

Query: 906  TLSWLSPPARWPPQPSSRPRPPAAPWAACRAWARPSACLCPRSAG---PSWAPATAATCC 1076
            T    +      P P+    P   P          +    P   G   P+  P T  T  
Sbjct: 4015 TPITTTTTVTPTPTPTGTQTPTTTP-----ITTTTTVTPTPTPTGTQTPTTTPITTTTTV 4069

Query: 1077 --PPSPLSTFTPSSTP 1118
               P+P  T TP++TP
Sbjct: 4070 TPTPTPTGTQTPTTTP 4085

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 89/376 (23%), Positives = 131/376 (34%), Gaps = 15/376 (3%)
 Frame = +3

Query: 36   SPWTTPPCTSPPTSRPSSQRLASLSPPTPARAAACWRASTRCTATSAPSRTSPPSTRWTC 215
            +P  TP  T  PT+ P +        PTP       +  T    T+  + T  P+   T 
Sbjct: 2828 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT----QTPTTTPITTTTTVTPTPTPTGTQ 2883

Query: 216  LNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAP---------PPPEPRTTAAAIC 368
               + P  T+    P  +P     P       TT   P         P   P TT   + 
Sbjct: 2884 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 2943

Query: 369  WPPPPDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPACSACRSWT 548
              P P    +P T+P   +T    + T  T   +PT          TTP    +   + T
Sbjct: 2944 PTPTPTGTQTPTTTPITTTTTVTPTPT-PTGTQTPT----------TTP---ITTTTTVT 2989

Query: 549  PAPAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSSTWAMSR 728
            P P P  +       +TPT TP+    T TPT     T        T  P T++T     
Sbjct: 2990 PTPTPTGT-------QTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVTP- 3036

Query: 729  RWARLPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPRWASCATWSR 905
                 P  + +  ++P     +  PTP+   T TP+T    ++++ T TP      T + 
Sbjct: 3037 --TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 3094

Query: 906  TLSWLSPPARWPPQPSSRPRPPAAPWAACRAWARPSACLCPRSAG---PSWAPATAATCC 1076
            T    +      P P+    P   P          +    P   G   P+  P T  T  
Sbjct: 3095 TPITTTTTVTPTPTPTGTQTPTTTP-----ITTTTTVTPTPTPTGTQTPTTTPITTTTTV 3149

Query: 1077 --PPSPLSTFTPSSTP 1118
               P+P  T TP++TP
Sbjct: 3150 TPTPTPTGTQTPTTTP 3165

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 89/376 (23%), Positives = 131/376 (34%), Gaps = 15/376 (3%)
 Frame = +3

Query: 36   SPWTTPPCTSPPTSRPSSQRLASLSPPTPARAAACWRASTRCTATSAPSRTSPPSTRWTC 215
            +P  TP  T  PT+ P +        PTP       +  T    T+  + T  P+   T 
Sbjct: 3058 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT----QTPTTTPITTTTTVTPTPTPTGTQ 3113

Query: 216  LNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAP---------PPPEPRTTAAAIC 368
               + P  T+    P  +P     P       TT   P         P   P TT   + 
Sbjct: 3114 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 3173

Query: 369  WPPPPDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPACSACRSWT 548
              P P    +P T+P   +T    + T  T   +PT          TTP    +   + T
Sbjct: 3174 PTPTPTGTQTPTTTPITTTTTVTPTPT-PTGTQTPT----------TTP---ITTTTTVT 3219

Query: 549  PAPAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSSTWAMSR 728
            P P P  +       +TPT TP+    T TPT     T        T  P T++T     
Sbjct: 3220 PTPTPTGT-------QTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVTP- 3266

Query: 729  RWARLPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPRWASCATWSR 905
                 P  + +  ++P     +  PTP+   T TP+T    ++++ T TP      T + 
Sbjct: 3267 --TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 3324

Query: 906  TLSWLSPPARWPPQPSSRPRPPAAPWAACRAWARPSACLCPRSAG---PSWAPATAATCC 1076
            T    +      P P+    P   P          +    P   G   P+  P T  T  
Sbjct: 3325 TPITTTTTVTPTPTPTGTQTPTTTP-----ITTTTTVTPTPTPTGTQTPTTTPITTTTTV 3379

Query: 1077 --PPSPLSTFTPSSTP 1118
               P+P  T TP++TP
Sbjct: 3380 TPTPTPTGTQTPTTTP 3395

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 89/376 (23%), Positives = 131/376 (34%), Gaps = 15/376 (3%)
 Frame = +3

Query: 36   SPWTTPPCTSPPTSRPSSQRLASLSPPTPARAAACWRASTRCTATSAPSRTSPPSTRWTC 215
            +P  TP  T  PT+ P +        PTP       +  T    T+  + T  P+   T 
Sbjct: 3081 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT----QTPTTTPITTTTTVTPTPTPTGTQ 3136

Query: 216  LNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAP---------PPPEPRTTAAAIC 368
               + P  T+    P  +P     P       TT   P         P   P TT   + 
Sbjct: 3137 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 3196

Query: 369  WPPPPDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPACSACRSWT 548
              P P    +P T+P   +T    + T  T   +PT          TTP    +   + T
Sbjct: 3197 PTPTPTGTQTPTTTPITTTTTVTPTPT-PTGTQTPT----------TTP---ITTTTTVT 3242

Query: 549  PAPAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSSTWAMSR 728
            P P P  +       +TPT TP+    T TPT     T        T  P T++T     
Sbjct: 3243 PTPTPTGT-------QTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVTP- 3289

Query: 729  RWARLPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPRWASCATWSR 905
                 P  + +  ++P     +  PTP+   T TP+T    ++++ T TP      T + 
Sbjct: 3290 --TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 3347

Query: 906  TLSWLSPPARWPPQPSSRPRPPAAPWAACRAWARPSACLCPRSAG---PSWAPATAATCC 1076
            T    +      P P+    P   P          +    P   G   P+  P T  T  
Sbjct: 3348 TPITTTTTVTPTPTPTGTQTPTTTP-----ITTTTTVTPTPTPTGTQTPTTTPITTTTTV 3402

Query: 1077 --PPSPLSTFTPSSTP 1118
               P+P  T TP++TP
Sbjct: 3403 TPTPTPTGTQTPTTTP 3418

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 89/376 (23%), Positives = 131/376 (34%), Gaps = 15/376 (3%)
 Frame = +3

Query: 36   SPWTTPPCTSPPTSRPSSQRLASLSPPTPARAAACWRASTRCTATSAPSRTSPPSTRWTC 215
            +P  TP  T  PT+ P +        PTP       +  T    T+  + T  P+   T 
Sbjct: 2368 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT----QTPTTTPITTTTTVTPTPTPTGTQ 2423

Query: 216  LNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAP---------PPPEPRTTAAAIC 368
               + P  T+    P  +P     P       TT   P         P   P TT   + 
Sbjct: 2424 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 2483

Query: 369  WPPPPDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPACSACRSWT 548
              P P    +P T+P   +T    + T  T   +PT          TTP    +   + T
Sbjct: 2484 PTPTPTGTQTPTTTPITTTTTVTPTPT-PTGTQTPT----------TTP---ITTTTTVT 2529

Query: 549  PAPAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSSTWAMSR 728
            P P P  +       +TPT TP+    T TPT     T        T  P T++T     
Sbjct: 2530 PTPTPTGT-------QTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVTP- 2576

Query: 729  RWARLPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPRWASCATWSR 905
                 P  + +  ++P     +  PTP+   T TP+T    ++++ T TP      T + 
Sbjct: 2577 --TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 2634

Query: 906  TLSWLSPPARWPPQPSSRPRPPAAPWAACRAWARPSACLCPRSAG---PSWAPATAATCC 1076
            T    +      P P+    P   P          +    P   G   P+  P T  T  
Sbjct: 2635 TPITTTTTVTPTPTPTGTQTPTTTP-----ITTTTTVTPTPTPTGTQTPTTTPITTTTTV 2689

Query: 1077 --PPSPLSTFTPSSTP 1118
               P+P  T TP++TP
Sbjct: 2690 TPTPTPTGTQTPTTTP 2705

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 89/376 (23%), Positives = 131/376 (34%), Gaps = 15/376 (3%)
 Frame = +3

Query: 36   SPWTTPPCTSPPTSRPSSQRLASLSPPTPARAAACWRASTRCTATSAPSRTSPPSTRWTC 215
            +P  TP  T  PT+ P +        PTP       +  T    T+  + T  P+   T 
Sbjct: 3127 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT----QTPTTTPITTTTTVTPTPTPTGTQ 3182

Query: 216  LNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAP---------PPPEPRTTAAAIC 368
               + P  T+    P  +P     P       TT   P         P   P TT   + 
Sbjct: 3183 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 3242

Query: 369  WPPPPDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPACSACRSWT 548
              P P    +P T+P   +T    + T  T   +PT          TTP    +   + T
Sbjct: 3243 PTPTPTGTQTPTTTPITTTTTVTPTPT-PTGTQTPT----------TTP---ITTTTTVT 3288

Query: 549  PAPAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSSTWAMSR 728
            P P P  +       +TPT TP+    T TPT     T        T  P T++T     
Sbjct: 3289 PTPTPTGT-------QTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVTP- 3335

Query: 729  RWARLPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPRWASCATWSR 905
                 P  + +  ++P     +  PTP+   T TP+T    ++++ T TP      T + 
Sbjct: 3336 --TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 3393

Query: 906  TLSWLSPPARWPPQPSSRPRPPAAPWAACRAWARPSACLCPRSAG---PSWAPATAATCC 1076
            T    +      P P+    P   P          +    P   G   P+  P T  T  
Sbjct: 3394 TPITTTTTVTPTPTPTGTQTPTTTP-----ITTTTTVTPTPTPTGTQTPTTTPITTTTTV 3448

Query: 1077 --PPSPLSTFTPSSTP 1118
               P+P  T TP++TP
Sbjct: 3449 TPTPTPTGTQTPTTTP 3464

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 89/376 (23%), Positives = 131/376 (34%), Gaps = 15/376 (3%)
 Frame = +3

Query: 36   SPWTTPPCTSPPTSRPSSQRLASLSPPTPARAAACWRASTRCTATSAPSRTSPPSTRWTC 215
            +P  TP  T  PT+ P +        PTP       +  T    T+  + T  P+   T 
Sbjct: 3150 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT----QTPTTTPITTTTTVTPTPTPTGTQ 3205

Query: 216  LNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAP---------PPPEPRTTAAAIC 368
               + P  T+    P  +P     P       TT   P         P   P TT   + 
Sbjct: 3206 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 3265

Query: 369  WPPPPDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPACSACRSWT 548
              P P    +P T+P   +T    + T  T   +PT          TTP    +   + T
Sbjct: 3266 PTPTPTGTQTPTTTPITTTTTVTPTPT-PTGTQTPT----------TTP---ITTTTTVT 3311

Query: 549  PAPAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSSTWAMSR 728
            P P P  +       +TPT TP+    T TPT     T        T  P T++T     
Sbjct: 3312 PTPTPTGT-------QTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVTP- 3358

Query: 729  RWARLPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPRWASCATWSR 905
                 P  + +  ++P     +  PTP+   T TP+T    ++++ T TP      T + 
Sbjct: 3359 --TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 3416

Query: 906  TLSWLSPPARWPPQPSSRPRPPAAPWAACRAWARPSACLCPRSAG---PSWAPATAATCC 1076
            T    +      P P+    P   P          +    P   G   P+  P T  T  
Sbjct: 3417 TPITTTTTVTPTPTPTGTQTPTTTP-----ITTTTTVTPTPTPTGTQTPTTTPITTTTTV 3471

Query: 1077 --PPSPLSTFTPSSTP 1118
               P+P  T TP++TP
Sbjct: 3472 TPTPTPTGTQTPTTTP 3487

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 89/376 (23%), Positives = 131/376 (34%), Gaps = 15/376 (3%)
 Frame = +3

Query: 36   SPWTTPPCTSPPTSRPSSQRLASLSPPTPARAAACWRASTRCTATSAPSRTSPPSTRWTC 215
            +P  TP  T  PT+ P +        PTP       +  T    T+  + T  P+   T 
Sbjct: 2805 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT----QTPTTTPITTTTTVTPTPTPTGTQ 2860

Query: 216  LNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAP---------PPPEPRTTAAAIC 368
               + P  T+    P  +P     P       TT   P         P   P TT   + 
Sbjct: 2861 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 2920

Query: 369  WPPPPDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPACSACRSWT 548
              P P    +P T+P   +T    + T  T   +PT          TTP    +   + T
Sbjct: 2921 PTPTPTGTQTPTTTPITTTTTVTPTPT-PTGTQTPT----------TTP---ITTTTTVT 2966

Query: 549  PAPAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSSTWAMSR 728
            P P P  +       +TPT TP+    T TPT     T        T  P T++T     
Sbjct: 2967 PTPTPTGT-------QTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVTP- 3013

Query: 729  RWARLPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPRWASCATWSR 905
                 P  + +  ++P     +  PTP+   T TP+T    ++++ T TP      T + 
Sbjct: 3014 --TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 3071

Query: 906  TLSWLSPPARWPPQPSSRPRPPAAPWAACRAWARPSACLCPRSAG---PSWAPATAATCC 1076
            T    +      P P+    P   P          +    P   G   P+  P T  T  
Sbjct: 3072 TPITTTTTVTPTPTPTGTQTPTTTP-----ITTTTTVTPTPTPTGTQTPTTTPITTTTTV 3126

Query: 1077 --PPSPLSTFTPSSTP 1118
               P+P  T TP++TP
Sbjct: 3127 TPTPTPTGTQTPTTTP 3142

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 89/376 (23%), Positives = 131/376 (34%), Gaps = 15/376 (3%)
 Frame = +3

Query: 36   SPWTTPPCTSPPTSRPSSQRLASLSPPTPARAAACWRASTRCTATSAPSRTSPPSTRWTC 215
            +P  TP  T  PT+ P +        PTP       +  T    T+  + T  P+   T 
Sbjct: 2782 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT----QTPTTTPITTTTTVTPTPTPTGTQ 2837

Query: 216  LNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAP---------PPPEPRTTAAAIC 368
               + P  T+    P  +P     P       TT   P         P   P TT   + 
Sbjct: 2838 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 2897

Query: 369  WPPPPDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPACSACRSWT 548
              P P    +P T+P   +T    + T  T   +PT          TTP    +   + T
Sbjct: 2898 PTPTPTGTQTPTTTPITTTTTVTPTPT-PTGTQTPT----------TTP---ITTTTTVT 2943

Query: 549  PAPAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSSTWAMSR 728
            P P P  +       +TPT TP+    T TPT     T        T  P T++T     
Sbjct: 2944 PTPTPTGT-------QTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVTP- 2990

Query: 729  RWARLPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPRWASCATWSR 905
                 P  + +  ++P     +  PTP+   T TP+T    ++++ T TP      T + 
Sbjct: 2991 --TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 3048

Query: 906  TLSWLSPPARWPPQPSSRPRPPAAPWAACRAWARPSACLCPRSAG---PSWAPATAATCC 1076
            T    +      P P+    P   P          +    P   G   P+  P T  T  
Sbjct: 3049 TPITTTTTVTPTPTPTGTQTPTTTP-----ITTTTTVTPTPTPTGTQTPTTTPITTTTTV 3103

Query: 1077 --PPSPLSTFTPSSTP 1118
               P+P  T TP++TP
Sbjct: 3104 TPTPTPTGTQTPTTTP 3119

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 89/376 (23%), Positives = 131/376 (34%), Gaps = 15/376 (3%)
 Frame = +3

Query: 36   SPWTTPPCTSPPTSRPSSQRLASLSPPTPARAAACWRASTRCTATSAPSRTSPPSTRWTC 215
            +P  TP  T  PT+ P +        PTP       +  T    T+  + T  P+   T 
Sbjct: 2345 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT----QTPTTTPITTTTTVTPTPTPTGTQ 2400

Query: 216  LNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAP---------PPPEPRTTAAAIC 368
               + P  T+    P  +P     P       TT   P         P   P TT   + 
Sbjct: 2401 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 2460

Query: 369  WPPPPDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPACSACRSWT 548
              P P    +P T+P   +T    + T  T   +PT          TTP    +   + T
Sbjct: 2461 PTPTPTGTQTPTTTPITTTTTVTPTPT-PTGTQTPT----------TTP---ITTTTTVT 2506

Query: 549  PAPAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSSTWAMSR 728
            P P P  +       +TPT TP+    T TPT     T        T  P T++T     
Sbjct: 2507 PTPTPTGT-------QTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVTP- 2553

Query: 729  RWARLPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPRWASCATWSR 905
                 P  + +  ++P     +  PTP+   T TP+T    ++++ T TP      T + 
Sbjct: 2554 --TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 2611

Query: 906  TLSWLSPPARWPPQPSSRPRPPAAPWAACRAWARPSACLCPRSAG---PSWAPATAATCC 1076
            T    +      P P+    P   P          +    P   G   P+  P T  T  
Sbjct: 2612 TPITTTTTVTPTPTPTGTQTPTTTP-----ITTTTTVTPTPTPTGTQTPTTTPITTTTTV 2666

Query: 1077 --PPSPLSTFTPSSTP 1118
               P+P  T TP++TP
Sbjct: 2667 TPTPTPTGTQTPTTTP 2682

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 89/376 (23%), Positives = 131/376 (34%), Gaps = 15/376 (3%)
 Frame = +3

Query: 36   SPWTTPPCTSPPTSRPSSQRLASLSPPTPARAAACWRASTRCTATSAPSRTSPPSTRWTC 215
            +P  TP  T  PT+ P +        PTP       +  T    T+  + T  P+   T 
Sbjct: 2759 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT----QTPTTTPITTTTTVTPTPTPTGTQ 2814

Query: 216  LNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAP---------PPPEPRTTAAAIC 368
               + P  T+    P  +P     P       TT   P         P   P TT   + 
Sbjct: 2815 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 2874

Query: 369  WPPPPDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPACSACRSWT 548
              P P    +P T+P   +T    + T  T   +PT          TTP    +   + T
Sbjct: 2875 PTPTPTGTQTPTTTPITTTTTVTPTPT-PTGTQTPT----------TTP---ITTTTTVT 2920

Query: 549  PAPAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSSTWAMSR 728
            P P P  +       +TPT TP+    T TPT     T        T  P T++T     
Sbjct: 2921 PTPTPTGT-------QTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVTP- 2967

Query: 729  RWARLPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPRWASCATWSR 905
                 P  + +  ++P     +  PTP+   T TP+T    ++++ T TP      T + 
Sbjct: 2968 --TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 3025

Query: 906  TLSWLSPPARWPPQPSSRPRPPAAPWAACRAWARPSACLCPRSAG---PSWAPATAATCC 1076
            T    +      P P+    P   P          +    P   G   P+  P T  T  
Sbjct: 3026 TPITTTTTVTPTPTPTGTQTPTTTP-----ITTTTTVTPTPTPTGTQTPTTTPITTTTTV 3080

Query: 1077 --PPSPLSTFTPSSTP 1118
               P+P  T TP++TP
Sbjct: 3081 TPTPTPTGTQTPTTTP 3096

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 89/376 (23%), Positives = 131/376 (34%), Gaps = 15/376 (3%)
 Frame = +3

Query: 36   SPWTTPPCTSPPTSRPSSQRLASLSPPTPARAAACWRASTRCTATSAPSRTSPPSTRWTC 215
            +P  TP  T  PT+ P +        PTP       +  T    T+  + T  P+   T 
Sbjct: 3265 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT----QTPTTTPITTTTTVTPTPTPTGTQ 3320

Query: 216  LNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAP---------PPPEPRTTAAAIC 368
               + P  T+    P  +P     P       TT   P         P   P TT   + 
Sbjct: 3321 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 3380

Query: 369  WPPPPDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPACSACRSWT 548
              P P    +P T+P   +T    + T  T   +PT          TTP    +   + T
Sbjct: 3381 PTPTPTGTQTPTTTPITTTTTVTPTPT-PTGTQTPT----------TTP---ITTTTTVT 3426

Query: 549  PAPAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSSTWAMSR 728
            P P P  +       +TPT TP+    T TPT     T        T  P T++T     
Sbjct: 3427 PTPTPTGT-------QTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVTP- 3473

Query: 729  RWARLPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPRWASCATWSR 905
                 P  + +  ++P     +  PTP+   T TP+T    ++++ T TP      T + 
Sbjct: 3474 --TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 3531

Query: 906  TLSWLSPPARWPPQPSSRPRPPAAPWAACRAWARPSACLCPRSAG---PSWAPATAATCC 1076
            T    +      P P+    P   P          +    P   G   P+  P T  T  
Sbjct: 3532 TPITTTTTVTPTPTPTGTQTPTTTP-----ITTTTTVTPTPTPTGTQTPTTTPITTTTTV 3586

Query: 1077 --PPSPLSTFTPSSTP 1118
               P+P  T TP++TP
Sbjct: 3587 TPTPTPTGTQTPTTTP 3602

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 89/376 (23%), Positives = 131/376 (34%), Gaps = 15/376 (3%)
 Frame = +3

Query: 36   SPWTTPPCTSPPTSRPSSQRLASLSPPTPARAAACWRASTRCTATSAPSRTSPPSTRWTC 215
            +P  TP  T  PT+ P +        PTP       +  T    T+  + T  P+   T 
Sbjct: 3587 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT----QTPTTTPITTTTTVTPTPTPTGTQ 3642

Query: 216  LNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAP---------PPPEPRTTAAAIC 368
               + P  T+    P  +P     P       TT   P         P   P TT   + 
Sbjct: 3643 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 3702

Query: 369  WPPPPDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPACSACRSWT 548
              P P    +P T+P   +T    + T  T   +PT          TTP    +   + T
Sbjct: 3703 PTPTPTGTQTPTTTPITTTTTVTPTPT-PTGTQTPT----------TTP---ITTTTTVT 3748

Query: 549  PAPAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSSTWAMSR 728
            P P P  +       +TPT TP+    T TPT     T        T  P T++T     
Sbjct: 3749 PTPTPTGT-------QTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVTP- 3795

Query: 729  RWARLPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPRWASCATWSR 905
                 P  + +  ++P     +  PTP+   T TP+T    ++++ T TP      T + 
Sbjct: 3796 --TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 3853

Query: 906  TLSWLSPPARWPPQPSSRPRPPAAPWAACRAWARPSACLCPRSAG---PSWAPATAATCC 1076
            T    +      P P+    P   P          +    P   G   P+  P T  T  
Sbjct: 3854 TPITTTTTVTPTPTPTGTQTPTTTP-----ITTTTTVTPTPTPTGTQTPTTTPITTTTTV 3908

Query: 1077 --PPSPLSTFTPSSTP 1118
               P+P  T TP++TP
Sbjct: 3909 TPTPTPTGTQTPTTTP 3924

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 89/376 (23%), Positives = 131/376 (34%), Gaps = 15/376 (3%)
 Frame = +3

Query: 36   SPWTTPPCTSPPTSRPSSQRLASLSPPTPARAAACWRASTRCTATSAPSRTSPPSTRWTC 215
            +P  TP  T  PT+ P +        PTP       +  T    T+  + T  P+   T 
Sbjct: 3311 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT----QTPTTTPITTTTTVTPTPTPTGTQ 3366

Query: 216  LNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAP---------PPPEPRTTAAAIC 368
               + P  T+    P  +P     P       TT   P         P   P TT   + 
Sbjct: 3367 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 3426

Query: 369  WPPPPDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPACSACRSWT 548
              P P    +P T+P   +T    + T  T   +PT          TTP    +   + T
Sbjct: 3427 PTPTPTGTQTPTTTPITTTTTVTPTPT-PTGTQTPT----------TTP---ITTTTTVT 3472

Query: 549  PAPAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSSTWAMSR 728
            P P P  +       +TPT TP+    T TPT     T        T  P T++T     
Sbjct: 3473 PTPTPTGT-------QTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVTP- 3519

Query: 729  RWARLPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPRWASCATWSR 905
                 P  + +  ++P     +  PTP+   T TP+T    ++++ T TP      T + 
Sbjct: 3520 --TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 3577

Query: 906  TLSWLSPPARWPPQPSSRPRPPAAPWAACRAWARPSACLCPRSAG---PSWAPATAATCC 1076
            T    +      P P+    P   P          +    P   G   P+  P T  T  
Sbjct: 3578 TPITTTTTVTPTPTPTGTQTPTTTP-----ITTTTTVTPTPTPTGTQTPTTTPITTTTTV 3632

Query: 1077 --PPSPLSTFTPSSTP 1118
               P+P  T TP++TP
Sbjct: 3633 TPTPTPTGTQTPTTTP 3648

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 89/376 (23%), Positives = 131/376 (34%), Gaps = 15/376 (3%)
 Frame = +3

Query: 36   SPWTTPPCTSPPTSRPSSQRLASLSPPTPARAAACWRASTRCTATSAPSRTSPPSTRWTC 215
            +P  TP  T  PT+ P +        PTP       +  T    T+  + T  P+   T 
Sbjct: 3334 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT----QTPTTTPITTTTTVTPTPTPTGTQ 3389

Query: 216  LNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAP---------PPPEPRTTAAAIC 368
               + P  T+    P  +P     P       TT   P         P   P TT   + 
Sbjct: 3390 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 3449

Query: 369  WPPPPDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPACSACRSWT 548
              P P    +P T+P   +T    + T  T   +PT          TTP    +   + T
Sbjct: 3450 PTPTPTGTQTPTTTPITTTTTVTPTPT-PTGTQTPT----------TTP---ITTTTTVT 3495

Query: 549  PAPAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSSTWAMSR 728
            P P P  +       +TPT TP+    T TPT     T        T  P T++T     
Sbjct: 3496 PTPTPTGT-------QTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVTP- 3542

Query: 729  RWARLPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPRWASCATWSR 905
                 P  + +  ++P     +  PTP+   T TP+T    ++++ T TP      T + 
Sbjct: 3543 --TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 3600

Query: 906  TLSWLSPPARWPPQPSSRPRPPAAPWAACRAWARPSACLCPRSAG---PSWAPATAATCC 1076
            T    +      P P+    P   P          +    P   G   P+  P T  T  
Sbjct: 3601 TPITTTTTVTPTPTPTGTQTPTTTP-----ITTTTTVTPTPTPTGTQTPTTTPITTTTTV 3655

Query: 1077 --PPSPLSTFTPSSTP 1118
               P+P  T TP++TP
Sbjct: 3656 TPTPTPTGTQTPTTTP 3671

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 89/376 (23%), Positives = 131/376 (34%), Gaps = 15/376 (3%)
 Frame = +3

Query: 36   SPWTTPPCTSPPTSRPSSQRLASLSPPTPARAAACWRASTRCTATSAPSRTSPPSTRWTC 215
            +P  TP  T  PT+ P +        PTP       +  T    T+  + T  P+   T 
Sbjct: 3357 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT----QTPTTTPITTTTTVTPTPTPTGTQ 3412

Query: 216  LNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAP---------PPPEPRTTAAAIC 368
               + P  T+    P  +P     P       TT   P         P   P TT   + 
Sbjct: 3413 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 3472

Query: 369  WPPPPDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPACSACRSWT 548
              P P    +P T+P   +T    + T  T   +PT          TTP    +   + T
Sbjct: 3473 PTPTPTGTQTPTTTPITTTTTVTPTPT-PTGTQTPT----------TTP---ITTTTTVT 3518

Query: 549  PAPAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSSTWAMSR 728
            P P P  +       +TPT TP+    T TPT     T        T  P T++T     
Sbjct: 3519 PTPTPTGT-------QTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVTP- 3565

Query: 729  RWARLPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPRWASCATWSR 905
                 P  + +  ++P     +  PTP+   T TP+T    ++++ T TP      T + 
Sbjct: 3566 --TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 3623

Query: 906  TLSWLSPPARWPPQPSSRPRPPAAPWAACRAWARPSACLCPRSAG---PSWAPATAATCC 1076
            T    +      P P+    P   P          +    P   G   P+  P T  T  
Sbjct: 3624 TPITTTTTVTPTPTPTGTQTPTTTP-----ITTTTTVTPTPTPTGTQTPTTTPITTTTTV 3678

Query: 1077 --PPSPLSTFTPSSTP 1118
               P+P  T TP++TP
Sbjct: 3679 TPTPTPTGTQTPTTTP 3694

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 89/376 (23%), Positives = 131/376 (34%), Gaps = 15/376 (3%)
 Frame = +3

Query: 36   SPWTTPPCTSPPTSRPSSQRLASLSPPTPARAAACWRASTRCTATSAPSRTSPPSTRWTC 215
            +P  TP  T  PT+ P +        PTP       +  T    T+  + T  P+   T 
Sbjct: 2736 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT----QTPTTTPITTTTTVTPTPTPTGTQ 2791

Query: 216  LNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAP---------PPPEPRTTAAAIC 368
               + P  T+    P  +P     P       TT   P         P   P TT   + 
Sbjct: 2792 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 2851

Query: 369  WPPPPDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPACSACRSWT 548
              P P    +P T+P   +T    + T  T   +PT          TTP    +   + T
Sbjct: 2852 PTPTPTGTQTPTTTPITTTTTVTPTPT-PTGTQTPT----------TTP---ITTTTTVT 2897

Query: 549  PAPAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSSTWAMSR 728
            P P P  +       +TPT TP+    T TPT     T        T  P T++T     
Sbjct: 2898 PTPTPTGT-------QTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVTP- 2944

Query: 729  RWARLPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPRWASCATWSR 905
                 P  + +  ++P     +  PTP+   T TP+T    ++++ T TP      T + 
Sbjct: 2945 --TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 3002

Query: 906  TLSWLSPPARWPPQPSSRPRPPAAPWAACRAWARPSACLCPRSAG---PSWAPATAATCC 1076
            T    +      P P+    P   P          +    P   G   P+  P T  T  
Sbjct: 3003 TPITTTTTVTPTPTPTGTQTPTTTP-----ITTTTTVTPTPTPTGTQTPTTTPITTTTTV 3057

Query: 1077 --PPSPLSTFTPSSTP 1118
               P+P  T TP++TP
Sbjct: 3058 TPTPTPTGTQTPTTTP 3073

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 89/376 (23%), Positives = 131/376 (34%), Gaps = 15/376 (3%)
 Frame = +3

Query: 36   SPWTTPPCTSPPTSRPSSQRLASLSPPTPARAAACWRASTRCTATSAPSRTSPPSTRWTC 215
            +P  TP  T  PT+ P +        PTP       +  T    T+  + T  P+   T 
Sbjct: 2322 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT----QTPTTTPITTTTTVTPTPTPTGTQ 2377

Query: 216  LNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAP---------PPPEPRTTAAAIC 368
               + P  T+    P  +P     P       TT   P         P   P TT   + 
Sbjct: 2378 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 2437

Query: 369  WPPPPDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPACSACRSWT 548
              P P    +P T+P   +T    + T  T   +PT          TTP    +   + T
Sbjct: 2438 PTPTPTGTQTPTTTPITTTTTVTPTPT-PTGTQTPT----------TTP---ITTTTTVT 2483

Query: 549  PAPAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSSTWAMSR 728
            P P P  +       +TPT TP+    T TPT     T        T  P T++T     
Sbjct: 2484 PTPTPTGT-------QTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVTP- 2530

Query: 729  RWARLPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPRWASCATWSR 905
                 P  + +  ++P     +  PTP+   T TP+T    ++++ T TP      T + 
Sbjct: 2531 --TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 2588

Query: 906  TLSWLSPPARWPPQPSSRPRPPAAPWAACRAWARPSACLCPRSAG---PSWAPATAATCC 1076
            T    +      P P+    P   P          +    P   G   P+  P T  T  
Sbjct: 2589 TPITTTTTVTPTPTPTGTQTPTTTP-----ITTTTTVTPTPTPTGTQTPTTTPITTTTTV 2643

Query: 1077 --PPSPLSTFTPSSTP 1118
               P+P  T TP++TP
Sbjct: 2644 TPTPTPTGTQTPTTTP 2659

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 89/376 (23%), Positives = 131/376 (34%), Gaps = 15/376 (3%)
 Frame = +3

Query: 36   SPWTTPPCTSPPTSRPSSQRLASLSPPTPARAAACWRASTRCTATSAPSRTSPPSTRWTC 215
            +P  TP  T  PT+ P +        PTP       +  T    T+  + T  P+   T 
Sbjct: 3518 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT----QTPTTTPITTTTTVTPTPTPTGTQ 3573

Query: 216  LNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAP---------PPPEPRTTAAAIC 368
               + P  T+    P  +P     P       TT   P         P   P TT   + 
Sbjct: 3574 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 3633

Query: 369  WPPPPDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPACSACRSWT 548
              P P    +P T+P   +T    + T  T   +PT          TTP    +   + T
Sbjct: 3634 PTPTPTGTQTPTTTPITTTTTVTPTPT-PTGTQTPT----------TTP---ITTTTTVT 3679

Query: 549  PAPAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSSTWAMSR 728
            P P P  +       +TPT TP+    T TPT     T        T  P T++T     
Sbjct: 3680 PTPTPTGT-------QTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVTP- 3726

Query: 729  RWARLPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPRWASCATWSR 905
                 P  + +  ++P     +  PTP+   T TP+T    ++++ T TP      T + 
Sbjct: 3727 --TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 3784

Query: 906  TLSWLSPPARWPPQPSSRPRPPAAPWAACRAWARPSACLCPRSAG---PSWAPATAATCC 1076
            T    +      P P+    P   P          +    P   G   P+  P T  T  
Sbjct: 3785 TPITTTTTVTPTPTPTGTQTPTTTP-----ITTTTTVTPTPTPTGTQTPTTTPITTTTTV 3839

Query: 1077 --PPSPLSTFTPSSTP 1118
               P+P  T TP++TP
Sbjct: 3840 TPTPTPTGTQTPTTTP 3855

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 89/376 (23%), Positives = 131/376 (34%), Gaps = 15/376 (3%)
 Frame = +3

Query: 36   SPWTTPPCTSPPTSRPSSQRLASLSPPTPARAAACWRASTRCTATSAPSRTSPPSTRWTC 215
            +P  TP  T  PT+ P +        PTP       +  T    T+  + T  P+   T 
Sbjct: 2713 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT----QTPTTTPITTTTTVTPTPTPTGTQ 2768

Query: 216  LNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAP---------PPPEPRTTAAAIC 368
               + P  T+    P  +P     P       TT   P         P   P TT   + 
Sbjct: 2769 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 2828

Query: 369  WPPPPDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPACSACRSWT 548
              P P    +P T+P   +T    + T  T   +PT          TTP    +   + T
Sbjct: 2829 PTPTPTGTQTPTTTPITTTTTVTPTPT-PTGTQTPT----------TTP---ITTTTTVT 2874

Query: 549  PAPAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSSTWAMSR 728
            P P P  +       +TPT TP+    T TPT     T        T  P T++T     
Sbjct: 2875 PTPTPTGT-------QTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVTP- 2921

Query: 729  RWARLPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPRWASCATWSR 905
                 P  + +  ++P     +  PTP+   T TP+T    ++++ T TP      T + 
Sbjct: 2922 --TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 2979

Query: 906  TLSWLSPPARWPPQPSSRPRPPAAPWAACRAWARPSACLCPRSAG---PSWAPATAATCC 1076
            T    +      P P+    P   P          +    P   G   P+  P T  T  
Sbjct: 2980 TPITTTTTVTPTPTPTGTQTPTTTP-----ITTTTTVTPTPTPTGTQTPTTTPITTTTTV 3034

Query: 1077 --PPSPLSTFTPSSTP 1118
               P+P  T TP++TP
Sbjct: 3035 TPTPTPTGTQTPTTTP 3050

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 89/376 (23%), Positives = 131/376 (34%), Gaps = 15/376 (3%)
 Frame = +3

Query: 36   SPWTTPPCTSPPTSRPSSQRLASLSPPTPARAAACWRASTRCTATSAPSRTSPPSTRWTC 215
            +P  TP  T  PT+ P +        PTP       +  T    T+  + T  P+   T 
Sbjct: 3495 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT----QTPTTTPITTTTTVTPTPTPTGTQ 3550

Query: 216  LNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAP---------PPPEPRTTAAAIC 368
               + P  T+    P  +P     P       TT   P         P   P TT   + 
Sbjct: 3551 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 3610

Query: 369  WPPPPDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPACSACRSWT 548
              P P    +P T+P   +T    + T  T   +PT          TTP    +   + T
Sbjct: 3611 PTPTPTGTQTPTTTPITTTTTVTPTPT-PTGTQTPT----------TTP---ITTTTTVT 3656

Query: 549  PAPAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSSTWAMSR 728
            P P P  +       +TPT TP+    T TPT     T        T  P T++T     
Sbjct: 3657 PTPTPTGT-------QTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVTP- 3703

Query: 729  RWARLPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPRWASCATWSR 905
                 P  + +  ++P     +  PTP+   T TP+T    ++++ T TP      T + 
Sbjct: 3704 --TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 3761

Query: 906  TLSWLSPPARWPPQPSSRPRPPAAPWAACRAWARPSACLCPRSAG---PSWAPATAATCC 1076
            T    +      P P+    P   P          +    P   G   P+  P T  T  
Sbjct: 3762 TPITTTTTVTPTPTPTGTQTPTTTP-----ITTTTTVTPTPTPTGTQTPTTTPITTTTTV 3816

Query: 1077 --PPSPLSTFTPSSTP 1118
               P+P  T TP++TP
Sbjct: 3817 TPTPTPTGTQTPTTTP 3832

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 89/376 (23%), Positives = 131/376 (34%), Gaps = 15/376 (3%)
 Frame = +3

Query: 36   SPWTTPPCTSPPTSRPSSQRLASLSPPTPARAAACWRASTRCTATSAPSRTSPPSTRWTC 215
            +P  TP  T  PT+ P +        PTP       +  T    T+  + T  P+   T 
Sbjct: 3472 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT----QTPTTTPITTTTTVTPTPTPTGTQ 3527

Query: 216  LNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAP---------PPPEPRTTAAAIC 368
               + P  T+    P  +P     P       TT   P         P   P TT   + 
Sbjct: 3528 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 3587

Query: 369  WPPPPDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPACSACRSWT 548
              P P    +P T+P   +T    + T  T   +PT          TTP    +   + T
Sbjct: 3588 PTPTPTGTQTPTTTPITTTTTVTPTPT-PTGTQTPT----------TTP---ITTTTTVT 3633

Query: 549  PAPAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSSTWAMSR 728
            P P P  +       +TPT TP+    T TPT     T        T  P T++T     
Sbjct: 3634 PTPTPTGT-------QTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVTP- 3680

Query: 729  RWARLPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPRWASCATWSR 905
                 P  + +  ++P     +  PTP+   T TP+T    ++++ T TP      T + 
Sbjct: 3681 --TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 3738

Query: 906  TLSWLSPPARWPPQPSSRPRPPAAPWAACRAWARPSACLCPRSAG---PSWAPATAATCC 1076
            T    +      P P+    P   P          +    P   G   P+  P T  T  
Sbjct: 3739 TPITTTTTVTPTPTPTGTQTPTTTP-----ITTTTTVTPTPTPTGTQTPTTTPITTTTTV 3793

Query: 1077 --PPSPLSTFTPSSTP 1118
               P+P  T TP++TP
Sbjct: 3794 TPTPTPTGTQTPTTTP 3809

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 89/376 (23%), Positives = 131/376 (34%), Gaps = 15/376 (3%)
 Frame = +3

Query: 36   SPWTTPPCTSPPTSRPSSQRLASLSPPTPARAAACWRASTRCTATSAPSRTSPPSTRWTC 215
            +P  TP  T  PT+ P +        PTP       +  T    T+  + T  P+   T 
Sbjct: 2690 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT----QTPTTTPITTTTTVTPTPTPTGTQ 2745

Query: 216  LNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAP---------PPPEPRTTAAAIC 368
               + P  T+    P  +P     P       TT   P         P   P TT   + 
Sbjct: 2746 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 2805

Query: 369  WPPPPDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPACSACRSWT 548
              P P    +P T+P   +T    + T  T   +PT          TTP    +   + T
Sbjct: 2806 PTPTPTGTQTPTTTPITTTTTVTPTPT-PTGTQTPT----------TTP---ITTTTTVT 2851

Query: 549  PAPAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSSTWAMSR 728
            P P P  +       +TPT TP+    T TPT     T        T  P T++T     
Sbjct: 2852 PTPTPTGT-------QTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVTP- 2898

Query: 729  RWARLPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPRWASCATWSR 905
                 P  + +  ++P     +  PTP+   T TP+T    ++++ T TP      T + 
Sbjct: 2899 --TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 2956

Query: 906  TLSWLSPPARWPPQPSSRPRPPAAPWAACRAWARPSACLCPRSAG---PSWAPATAATCC 1076
            T    +      P P+    P   P          +    P   G   P+  P T  T  
Sbjct: 2957 TPITTTTTVTPTPTPTGTQTPTTTP-----ITTTTTVTPTPTPTGTQTPTTTPITTTTTV 3011

Query: 1077 --PPSPLSTFTPSSTP 1118
               P+P  T TP++TP
Sbjct: 3012 TPTPTPTGTQTPTTTP 3027

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 89/376 (23%), Positives = 131/376 (34%), Gaps = 15/376 (3%)
 Frame = +3

Query: 36   SPWTTPPCTSPPTSRPSSQRLASLSPPTPARAAACWRASTRCTATSAPSRTSPPSTRWTC 215
            +P  TP  T  PT+ P +        PTP       +  T    T+  + T  P+   T 
Sbjct: 2299 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT----QTPTTTPITTTTTVTPTPTPTGTQ 2354

Query: 216  LNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAP---------PPPEPRTTAAAIC 368
               + P  T+    P  +P     P       TT   P         P   P TT   + 
Sbjct: 2355 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 2414

Query: 369  WPPPPDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPACSACRSWT 548
              P P    +P T+P   +T    + T  T   +PT          TTP    +   + T
Sbjct: 2415 PTPTPTGTQTPTTTPITTTTTVTPTPT-PTGTQTPT----------TTP---ITTTTTVT 2460

Query: 549  PAPAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSSTWAMSR 728
            P P P  +       +TPT TP+    T TPT     T        T  P T++T     
Sbjct: 2461 PTPTPTGT-------QTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVTP- 2507

Query: 729  RWARLPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPRWASCATWSR 905
                 P  + +  ++P     +  PTP+   T TP+T    ++++ T TP      T + 
Sbjct: 2508 --TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 2565

Query: 906  TLSWLSPPARWPPQPSSRPRPPAAPWAACRAWARPSACLCPRSAG---PSWAPATAATCC 1076
            T    +      P P+    P   P          +    P   G   P+  P T  T  
Sbjct: 2566 TPITTTTTVTPTPTPTGTQTPTTTP-----ITTTTTVTPTPTPTGTQTPTTTPITTTTTV 2620

Query: 1077 --PPSPLSTFTPSSTP 1118
               P+P  T TP++TP
Sbjct: 2621 TPTPTPTGTQTPTTTP 2636

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 89/376 (23%), Positives = 131/376 (34%), Gaps = 15/376 (3%)
 Frame = +3

Query: 36   SPWTTPPCTSPPTSRPSSQRLASLSPPTPARAAACWRASTRCTATSAPSRTSPPSTRWTC 215
            +P  TP  T  PT+ P +        PTP       +  T    T+  + T  P+   T 
Sbjct: 3449 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT----QTPTTTPITTTTTVTPTPTPTGTQ 3504

Query: 216  LNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAP---------PPPEPRTTAAAIC 368
               + P  T+    P  +P     P       TT   P         P   P TT   + 
Sbjct: 3505 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 3564

Query: 369  WPPPPDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPACSACRSWT 548
              P P    +P T+P   +T    + T  T   +PT          TTP    +   + T
Sbjct: 3565 PTPTPTGTQTPTTTPITTTTTVTPTPT-PTGTQTPT----------TTP---ITTTTTVT 3610

Query: 549  PAPAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSSTWAMSR 728
            P P P  +       +TPT TP+    T TPT     T        T  P T++T     
Sbjct: 3611 PTPTPTGT-------QTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVTP- 3657

Query: 729  RWARLPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPRWASCATWSR 905
                 P  + +  ++P     +  PTP+   T TP+T    ++++ T TP      T + 
Sbjct: 3658 --TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 3715

Query: 906  TLSWLSPPARWPPQPSSRPRPPAAPWAACRAWARPSACLCPRSAG---PSWAPATAATCC 1076
            T    +      P P+    P   P          +    P   G   P+  P T  T  
Sbjct: 3716 TPITTTTTVTPTPTPTGTQTPTTTP-----ITTTTTVTPTPTPTGTQTPTTTPITTTTTV 3770

Query: 1077 --PPSPLSTFTPSSTP 1118
               P+P  T TP++TP
Sbjct: 3771 TPTPTPTGTQTPTTTP 3786

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 89/376 (23%), Positives = 131/376 (34%), Gaps = 15/376 (3%)
 Frame = +3

Query: 36   SPWTTPPCTSPPTSRPSSQRLASLSPPTPARAAACWRASTRCTATSAPSRTSPPSTRWTC 215
            +P  TP  T  PT+ P +        PTP       +  T    T+  + T  P+   T 
Sbjct: 3426 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT----QTPTTTPITTTTTVTPTPTPTGTQ 3481

Query: 216  LNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAP---------PPPEPRTTAAAIC 368
               + P  T+    P  +P     P       TT   P         P   P TT   + 
Sbjct: 3482 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 3541

Query: 369  WPPPPDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPACSACRSWT 548
              P P    +P T+P   +T    + T  T   +PT          TTP    +   + T
Sbjct: 3542 PTPTPTGTQTPTTTPITTTTTVTPTPT-PTGTQTPT----------TTP---ITTTTTVT 3587

Query: 549  PAPAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSSTWAMSR 728
            P P P  +       +TPT TP+    T TPT     T        T  P T++T     
Sbjct: 3588 PTPTPTGT-------QTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVTP- 3634

Query: 729  RWARLPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPRWASCATWSR 905
                 P  + +  ++P     +  PTP+   T TP+T    ++++ T TP      T + 
Sbjct: 3635 --TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 3692

Query: 906  TLSWLSPPARWPPQPSSRPRPPAAPWAACRAWARPSACLCPRSAG---PSWAPATAATCC 1076
            T    +      P P+    P   P          +    P   G   P+  P T  T  
Sbjct: 3693 TPITTTTTVTPTPTPTGTQTPTTTP-----ITTTTTVTPTPTPTGTQTPTTTPITTTTTV 3747

Query: 1077 --PPSPLSTFTPSSTP 1118
               P+P  T TP++TP
Sbjct: 3748 TPTPTPTGTQTPTTTP 3763

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 89/376 (23%), Positives = 131/376 (34%), Gaps = 15/376 (3%)
 Frame = +3

Query: 36   SPWTTPPCTSPPTSRPSSQRLASLSPPTPARAAACWRASTRCTATSAPSRTSPPSTRWTC 215
            +P  TP  T  PT+ P +        PTP       +  T    T+  + T  P+   T 
Sbjct: 3610 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT----QTPTTTPITTTTTVTPTPTPTGTQ 3665

Query: 216  LNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAP---------PPPEPRTTAAAIC 368
               + P  T+    P  +P     P       TT   P         P   P TT   + 
Sbjct: 3666 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 3725

Query: 369  WPPPPDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPACSACRSWT 548
              P P    +P T+P   +T    + T  T   +PT          TTP    +   + T
Sbjct: 3726 PTPTPTGTQTPTTTPITTTTTVTPTPT-PTGTQTPT----------TTP---ITTTTTVT 3771

Query: 549  PAPAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSSTWAMSR 728
            P P P  +       +TPT TP+    T TPT     T        T  P T++T     
Sbjct: 3772 PTPTPTGT-------QTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVTP- 3818

Query: 729  RWARLPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPRWASCATWSR 905
                 P  + +  ++P     +  PTP+   T TP+T    ++++ T TP      T + 
Sbjct: 3819 --TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 3876

Query: 906  TLSWLSPPARWPPQPSSRPRPPAAPWAACRAWARPSACLCPRSAG---PSWAPATAATCC 1076
            T    +      P P+    P   P          +    P   G   P+  P T  T  
Sbjct: 3877 TPITTTTTVTPTPTPTGTQTPTTTP-----ITTTTTVTPTPTPTGTQTPTTTPITTTTTV 3931

Query: 1077 --PPSPLSTFTPSSTP 1118
               P+P  T TP++TP
Sbjct: 3932 TPTPTPTGTQTPTTTP 3947

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 89/376 (23%), Positives = 131/376 (34%), Gaps = 15/376 (3%)
 Frame = +3

Query: 36   SPWTTPPCTSPPTSRPSSQRLASLSPPTPARAAACWRASTRCTATSAPSRTSPPSTRWTC 215
            +P  TP  T  PT+ P +        PTP       +  T    T+  + T  P+   T 
Sbjct: 3633 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT----QTPTTTPITTTTTVTPTPTPTGTQ 3688

Query: 216  LNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAP---------PPPEPRTTAAAIC 368
               + P  T+    P  +P     P       TT   P         P   P TT   + 
Sbjct: 3689 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 3748

Query: 369  WPPPPDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPACSACRSWT 548
              P P    +P T+P   +T    + T  T   +PT          TTP    +   + T
Sbjct: 3749 PTPTPTGTQTPTTTPITTTTTVTPTPT-PTGTQTPT----------TTP---ITTTTTVT 3794

Query: 549  PAPAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSSTWAMSR 728
            P P P  +       +TPT TP+    T TPT     T        T  P T++T     
Sbjct: 3795 PTPTPTGT-------QTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVTP- 3841

Query: 729  RWARLPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPRWASCATWSR 905
                 P  + +  ++P     +  PTP+   T TP+T    ++++ T TP      T + 
Sbjct: 3842 --TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 3899

Query: 906  TLSWLSPPARWPPQPSSRPRPPAAPWAACRAWARPSACLCPRSAG---PSWAPATAATCC 1076
            T    +      P P+    P   P          +    P   G   P+  P T  T  
Sbjct: 3900 TPITTTTTVTPTPTPTGTQTPTTTP-----ITTTTTVTPTPTPTGTQTPTTTPITTTTTV 3954

Query: 1077 --PPSPLSTFTPSSTP 1118
               P+P  T TP++TP
Sbjct: 3955 TPTPTPTGTQTPTTTP 3970

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 89/376 (23%), Positives = 131/376 (34%), Gaps = 15/376 (3%)
 Frame = +3

Query: 36   SPWTTPPCTSPPTSRPSSQRLASLSPPTPARAAACWRASTRCTATSAPSRTSPPSTRWTC 215
            +P  TP  T  PT+ P +        PTP       +  T    T+  + T  P+   T 
Sbjct: 3656 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT----QTPTTTPITTTTTVTPTPTPTGTQ 3711

Query: 216  LNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAP---------PPPEPRTTAAAIC 368
               + P  T+    P  +P     P       TT   P         P   P TT   + 
Sbjct: 3712 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 3771

Query: 369  WPPPPDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPACSACRSWT 548
              P P    +P T+P   +T    + T  T   +PT          TTP    +   + T
Sbjct: 3772 PTPTPTGTQTPTTTPITTTTTVTPTPT-PTGTQTPT----------TTP---ITTTTTVT 3817

Query: 549  PAPAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSSTWAMSR 728
            P P P  +       +TPT TP+    T TPT     T        T  P T++T     
Sbjct: 3818 PTPTPTGT-------QTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVTP- 3864

Query: 729  RWARLPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPRWASCATWSR 905
                 P  + +  ++P     +  PTP+   T TP+T    ++++ T TP      T + 
Sbjct: 3865 --TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 3922

Query: 906  TLSWLSPPARWPPQPSSRPRPPAAPWAACRAWARPSACLCPRSAG---PSWAPATAATCC 1076
            T    +      P P+    P   P          +    P   G   P+  P T  T  
Sbjct: 3923 TPITTTTTVTPTPTPTGTQTPTTTP-----ITTTTTVTPTPTPTGTQTPTTTPITTTTTV 3977

Query: 1077 --PPSPLSTFTPSSTP 1118
               P+P  T TP++TP
Sbjct: 3978 TPTPTPTGTQTPTTTP 3993

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 89/376 (23%), Positives = 131/376 (34%), Gaps = 15/376 (3%)
 Frame = +3

Query: 36   SPWTTPPCTSPPTSRPSSQRLASLSPPTPARAAACWRASTRCTATSAPSRTSPPSTRWTC 215
            +P  TP  T  PT+ P +        PTP       +  T    T+  + T  P+   T 
Sbjct: 3679 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT----QTPTTTPITTTTTVTPTPTPTGTQ 3734

Query: 216  LNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAP---------PPPEPRTTAAAIC 368
               + P  T+    P  +P     P       TT   P         P   P TT   + 
Sbjct: 3735 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 3794

Query: 369  WPPPPDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPACSACRSWT 548
              P P    +P T+P   +T    + T  T   +PT          TTP    +   + T
Sbjct: 3795 PTPTPTGTQTPTTTPITTTTTVTPTPT-PTGTQTPT----------TTP---ITTTTTVT 3840

Query: 549  PAPAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSSTWAMSR 728
            P P P  +       +TPT TP+    T TPT     T        T  P T++T     
Sbjct: 3841 PTPTPTGT-------QTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVTP- 3887

Query: 729  RWARLPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPRWASCATWSR 905
                 P  + +  ++P     +  PTP+   T TP+T    ++++ T TP      T + 
Sbjct: 3888 --TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 3945

Query: 906  TLSWLSPPARWPPQPSSRPRPPAAPWAACRAWARPSACLCPRSAG---PSWAPATAATCC 1076
            T    +      P P+    P   P          +    P   G   P+  P T  T  
Sbjct: 3946 TPITTTTTVTPTPTPTGTQTPTTTP-----ITTTTTVTPTPTPTGTQTPTTTPITTTTTV 4000

Query: 1077 --PPSPLSTFTPSSTP 1118
               P+P  T TP++TP
Sbjct: 4001 TPTPTPTGTQTPTTTP 4016

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 89/376 (23%), Positives = 131/376 (34%), Gaps = 15/376 (3%)
 Frame = +3

Query: 36   SPWTTPPCTSPPTSRPSSQRLASLSPPTPARAAACWRASTRCTATSAPSRTSPPSTRWTC 215
            +P  TP  T  PT+ P +        PTP       +  T    T+  + T  P+   T 
Sbjct: 3702 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT----QTPTTTPITTTTTVTPTPTPTGTQ 3757

Query: 216  LNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAP---------PPPEPRTTAAAIC 368
               + P  T+    P  +P     P       TT   P         P   P TT   + 
Sbjct: 3758 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 3817

Query: 369  WPPPPDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPACSACRSWT 548
              P P    +P T+P   +T    + T  T   +PT          TTP    +   + T
Sbjct: 3818 PTPTPTGTQTPTTTPITTTTTVTPTPT-PTGTQTPT----------TTP---ITTTTTVT 3863

Query: 549  PAPAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSSTWAMSR 728
            P P P  +       +TPT TP+    T TPT     T        T  P T++T     
Sbjct: 3864 PTPTPTGT-------QTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVTP- 3910

Query: 729  RWARLPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPRWASCATWSR 905
                 P  + +  ++P     +  PTP+   T TP+T    ++++ T TP      T + 
Sbjct: 3911 --TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 3968

Query: 906  TLSWLSPPARWPPQPSSRPRPPAAPWAACRAWARPSACLCPRSAG---PSWAPATAATCC 1076
            T    +      P P+    P   P          +    P   G   P+  P T  T  
Sbjct: 3969 TPITTTTTVTPTPTPTGTQTPTTTP-----ITTTTTVTPTPTPTGTQTPTTTPITTTTTV 4023

Query: 1077 --PPSPLSTFTPSSTP 1118
               P+P  T TP++TP
Sbjct: 4024 TPTPTPTGTQTPTTTP 4039

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 89/376 (23%), Positives = 131/376 (34%), Gaps = 15/376 (3%)
 Frame = +3

Query: 36   SPWTTPPCTSPPTSRPSSQRLASLSPPTPARAAACWRASTRCTATSAPSRTSPPSTRWTC 215
            +P  TP  T  PT+ P +        PTP       +  T    T+  + T  P+   T 
Sbjct: 3725 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT----QTPTTTPITTTTTVTPTPTPTGTQ 3780

Query: 216  LNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAP---------PPPEPRTTAAAIC 368
               + P  T+    P  +P     P       TT   P         P   P TT   + 
Sbjct: 3781 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 3840

Query: 369  WPPPPDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPACSACRSWT 548
              P P    +P T+P   +T    + T  T   +PT          TTP    +   + T
Sbjct: 3841 PTPTPTGTQTPTTTPITTTTTVTPTPT-PTGTQTPT----------TTP---ITTTTTVT 3886

Query: 549  PAPAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSSTWAMSR 728
            P P P  +       +TPT TP+    T TPT     T        T  P T++T     
Sbjct: 3887 PTPTPTGT-------QTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVTP- 3933

Query: 729  RWARLPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPRWASCATWSR 905
                 P  + +  ++P     +  PTP+   T TP+T    ++++ T TP      T + 
Sbjct: 3934 --TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 3991

Query: 906  TLSWLSPPARWPPQPSSRPRPPAAPWAACRAWARPSACLCPRSAG---PSWAPATAATCC 1076
            T    +      P P+    P   P          +    P   G   P+  P T  T  
Sbjct: 3992 TPITTTTTVTPTPTPTGTQTPTTTP-----ITTTTTVTPTPTPTGTQTPTTTPITTTTTV 4046

Query: 1077 --PPSPLSTFTPSSTP 1118
               P+P  T TP++TP
Sbjct: 4047 TPTPTPTGTQTPTTTP 4062

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 89/376 (23%), Positives = 131/376 (34%), Gaps = 15/376 (3%)
 Frame = +3

Query: 36   SPWTTPPCTSPPTSRPSSQRLASLSPPTPARAAACWRASTRCTATSAPSRTSPPSTRWTC 215
            +P  TP  T  PT+ P +        PTP       +  T    T+  + T  P+   T 
Sbjct: 3403 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT----QTPTTTPITTTTTVTPTPTPTGTQ 3458

Query: 216  LNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAP---------PPPEPRTTAAAIC 368
               + P  T+    P  +P     P       TT   P         P   P TT   + 
Sbjct: 3459 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 3518

Query: 369  WPPPPDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPACSACRSWT 548
              P P    +P T+P   +T    + T  T   +PT          TTP    +   + T
Sbjct: 3519 PTPTPTGTQTPTTTPITTTTTVTPTPT-PTGTQTPT----------TTP---ITTTTTVT 3564

Query: 549  PAPAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSSTWAMSR 728
            P P P  +       +TPT TP+    T TPT     T        T  P T++T     
Sbjct: 3565 PTPTPTGT-------QTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVTP- 3611

Query: 729  RWARLPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPRWASCATWSR 905
                 P  + +  ++P     +  PTP+   T TP+T    ++++ T TP      T + 
Sbjct: 3612 --TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 3669

Query: 906  TLSWLSPPARWPPQPSSRPRPPAAPWAACRAWARPSACLCPRSAG---PSWAPATAATCC 1076
            T    +      P P+    P   P          +    P   G   P+  P T  T  
Sbjct: 3670 TPITTTTTVTPTPTPTGTQTPTTTP-----ITTTTTVTPTPTPTGTQTPTTTPITTTTTV 3724

Query: 1077 --PPSPLSTFTPSSTP 1118
               P+P  T TP++TP
Sbjct: 3725 TPTPTPTGTQTPTTTP 3740

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 89/376 (23%), Positives = 131/376 (34%), Gaps = 15/376 (3%)
 Frame = +3

Query: 36   SPWTTPPCTSPPTSRPSSQRLASLSPPTPARAAACWRASTRCTATSAPSRTSPPSTRWTC 215
            +P  TP  T  PT+ P +        PTP       +  T    T+  + T  P+   T 
Sbjct: 3380 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT----QTPTTTPITTTTTVTPTPTPTGTQ 3435

Query: 216  LNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAP---------PPPEPRTTAAAIC 368
               + P  T+    P  +P     P       TT   P         P   P TT   + 
Sbjct: 3436 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 3495

Query: 369  WPPPPDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPACSACRSWT 548
              P P    +P T+P   +T    + T  T   +PT          TTP    +   + T
Sbjct: 3496 PTPTPTGTQTPTTTPITTTTTVTPTPT-PTGTQTPT----------TTP---ITTTTTVT 3541

Query: 549  PAPAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSSTWAMSR 728
            P P P  +       +TPT TP+    T TPT     T        T  P T++T     
Sbjct: 3542 PTPTPTGT-------QTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVTP- 3588

Query: 729  RWARLPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPRWASCATWSR 905
                 P  + +  ++P     +  PTP+   T TP+T    ++++ T TP      T + 
Sbjct: 3589 --TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 3646

Query: 906  TLSWLSPPARWPPQPSSRPRPPAAPWAACRAWARPSACLCPRSAG---PSWAPATAATCC 1076
            T    +      P P+    P   P          +    P   G   P+  P T  T  
Sbjct: 3647 TPITTTTTVTPTPTPTGTQTPTTTP-----ITTTTTVTPTPTPTGTQTPTTTPITTTTTV 3701

Query: 1077 --PPSPLSTFTPSSTP 1118
               P+P  T TP++TP
Sbjct: 3702 TPTPTPTGTQTPTTTP 3717

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 89/376 (23%), Positives = 131/376 (34%), Gaps = 15/376 (3%)
 Frame = +3

Query: 36   SPWTTPPCTSPPTSRPSSQRLASLSPPTPARAAACWRASTRCTATSAPSRTSPPSTRWTC 215
            +P  TP  T  PT+ P +        PTP       +  T    T+  + T  P+   T 
Sbjct: 2644 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT----QTPTTTPITTTTTVTPTPTPTGTQ 2699

Query: 216  LNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAP---------PPPEPRTTAAAIC 368
               + P  T+    P  +P     P       TT   P         P   P TT   + 
Sbjct: 2700 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 2759

Query: 369  WPPPPDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPACSACRSWT 548
              P P    +P T+P   +T    + T  T   +PT          TTP    +   + T
Sbjct: 2760 PTPTPTGTQTPTTTPITTTTTVTPTPT-PTGTQTPT----------TTP---ITTTTTVT 2805

Query: 549  PAPAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSSTWAMSR 728
            P P P  +       +TPT TP+    T TPT     T        T  P T++T     
Sbjct: 2806 PTPTPTGT-------QTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVTP- 2852

Query: 729  RWARLPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPRWASCATWSR 905
                 P  + +  ++P     +  PTP+   T TP+T    ++++ T TP      T + 
Sbjct: 2853 --TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 2910

Query: 906  TLSWLSPPARWPPQPSSRPRPPAAPWAACRAWARPSACLCPRSAG---PSWAPATAATCC 1076
            T    +      P P+    P   P          +    P   G   P+  P T  T  
Sbjct: 2911 TPITTTTTVTPTPTPTGTQTPTTTP-----ITTTTTVTPTPTPTGTQTPTTTPITTTTTV 2965

Query: 1077 --PPSPLSTFTPSSTP 1118
               P+P  T TP++TP
Sbjct: 2966 TPTPTPTGTQTPTTTP 2981

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 89/376 (23%), Positives = 131/376 (34%), Gaps = 15/376 (3%)
 Frame = +3

Query: 36   SPWTTPPCTSPPTSRPSSQRLASLSPPTPARAAACWRASTRCTATSAPSRTSPPSTRWTC 215
            +P  TP  T  PT+ P +        PTP       +  T    T+  + T  P+   T 
Sbjct: 3817 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT----QTPTTTPITTTTTVTPTPTPTGTQ 3872

Query: 216  LNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAP---------PPPEPRTTAAAIC 368
               + P  T+    P  +P     P       TT   P         P   P TT   + 
Sbjct: 3873 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 3932

Query: 369  WPPPPDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPACSACRSWT 548
              P P    +P T+P   +T    + T  T   +PT          TTP    +   + T
Sbjct: 3933 PTPTPTGTQTPTTTPITTTTTVTPTPT-PTGTQTPT----------TTP---ITTTTTVT 3978

Query: 549  PAPAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSSTWAMSR 728
            P P P  +       +TPT TP+    T TPT     T        T  P T++T     
Sbjct: 3979 PTPTPTGT-------QTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVTP- 4025

Query: 729  RWARLPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPRWASCATWSR 905
                 P  + +  ++P     +  PTP+   T TP+T    ++++ T TP      T + 
Sbjct: 4026 --TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 4083

Query: 906  TLSWLSPPARWPPQPSSRPRPPAAPWAACRAWARPSACLCPRSAG---PSWAPATAATCC 1076
            T    +      P P+    P   P          +    P   G   P+  P T  T  
Sbjct: 4084 TPITTTTTVTPTPTPTGTQTPTTTP-----ITTTTTVTPTPTPTGTQTPTTTPITTTTTV 4138

Query: 1077 --PPSPLSTFTPSSTP 1118
               P+P  T TP++TP
Sbjct: 4139 TPTPTPTGTQTPTTTP 4154

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 89/376 (23%), Positives = 131/376 (34%), Gaps = 15/376 (3%)
 Frame = +3

Query: 36   SPWTTPPCTSPPTSRPSSQRLASLSPPTPARAAACWRASTRCTATSAPSRTSPPSTRWTC 215
            +P  TP  T  PT+ P +        PTP       +  T    T+  + T  P+   T 
Sbjct: 2276 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT----QTPTTTPITTTTTVTPTPTPTGTQ 2331

Query: 216  LNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAP---------PPPEPRTTAAAIC 368
               + P  T+    P  +P     P       TT   P         P   P TT   + 
Sbjct: 2332 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 2391

Query: 369  WPPPPDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPACSACRSWT 548
              P P    +P T+P   +T    + T  T   +PT          TTP    +   + T
Sbjct: 2392 PTPTPTGTQTPTTTPITTTTTVTPTPT-PTGTQTPT----------TTP---ITTTTTVT 2437

Query: 549  PAPAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSSTWAMSR 728
            P P P  +       +TPT TP+    T TPT     T        T  P T++T     
Sbjct: 2438 PTPTPTGT-------QTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVTP- 2484

Query: 729  RWARLPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPRWASCATWSR 905
                 P  + +  ++P     +  PTP+   T TP+T    ++++ T TP      T + 
Sbjct: 2485 --TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 2542

Query: 906  TLSWLSPPARWPPQPSSRPRPPAAPWAACRAWARPSACLCPRSAG---PSWAPATAATCC 1076
            T    +      P P+    P   P          +    P   G   P+  P T  T  
Sbjct: 2543 TPITTTTTVTPTPTPTGTQTPTTTP-----ITTTTTVTPTPTPTGTQTPTTTPITTTTTV 2597

Query: 1077 --PPSPLSTFTPSSTP 1118
               P+P  T TP++TP
Sbjct: 2598 TPTPTPTGTQTPTTTP 2613

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 89/376 (23%), Positives = 131/376 (34%), Gaps = 15/376 (3%)
 Frame = +3

Query: 36   SPWTTPPCTSPPTSRPSSQRLASLSPPTPARAAACWRASTRCTATSAPSRTSPPSTRWTC 215
            +P  TP  T  PT+ P +        PTP       +  T    T+  + T  P+   T 
Sbjct: 2874 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT----QTPTTTPITTTTTVTPTPTPTGTQ 2929

Query: 216  LNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAP---------PPPEPRTTAAAIC 368
               + P  T+    P  +P     P       TT   P         P   P TT   + 
Sbjct: 2930 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 2989

Query: 369  WPPPPDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPACSACRSWT 548
              P P    +P T+P   +T    + T  T   +PT          TTP    +   + T
Sbjct: 2990 PTPTPTGTQTPTTTPITTTTTVTPTPT-PTGTQTPT----------TTP---ITTTTTVT 3035

Query: 549  PAPAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSSTWAMSR 728
            P P P  +       +TPT TP+    T TPT     T        T  P T++T     
Sbjct: 3036 PTPTPTGT-------QTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVTP- 3082

Query: 729  RWARLPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPRWASCATWSR 905
                 P  + +  ++P     +  PTP+   T TP+T    ++++ T TP      T + 
Sbjct: 3083 --TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 3140

Query: 906  TLSWLSPPARWPPQPSSRPRPPAAPWAACRAWARPSACLCPRSAG---PSWAPATAATCC 1076
            T    +      P P+    P   P          +    P   G   P+  P T  T  
Sbjct: 3141 TPITTTTTVTPTPTPTGTQTPTTTP-----ITTTTTVTPTPTPTGTQTPTTTPITTTTTV 3195

Query: 1077 --PPSPLSTFTPSSTP 1118
               P+P  T TP++TP
Sbjct: 3196 TPTPTPTGTQTPTTTP 3211

 Score = 71.6 bits (174), Expect = 2e-11
 Identities = 89/376 (23%), Positives = 131/376 (34%), Gaps = 15/376 (3%)
 Frame = +3

Query: 36   SPWTTPPCTSPPTSRPSSQRLASLSPPTPARAAACWRASTRCTATSAPSRTSPPSTRWTC 215
            +P  TP  T  PT+ P +        PTP       +  T    T+  + T  P+   T 
Sbjct: 2897 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT----QTPTTTPITTTTTVTPTPTPTGTQ 2952

Query: 216  LNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAP---------PPPEPRTTAAAIC 368
               + P  T+    P  +P     P       TT   P         P   P TT   + 
Sbjct: 2953 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 3012

Query: 369  WPPPPDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPACSACRSWT 548
              P P    +P T+P   +T    + T  T   +PT          TTP    +   + T
Sbjct: 3013 PTPTPTGTQTPTTTPITTTTTVTPTPT-PTGTQTPT----------TTP---ITTTTTVT 3058

Query: 549  PAPAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSSTWAMSR 728
            P P P  +       +TPT TP+    T TPT     T        T  P T++T     
Sbjct: 3059 PTPTPTGT-------QTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVTP- 3105

Query: 729  RWARLPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPRWASCATWSR 905
                 P  + +  ++P     +  PTP+   T TP+T    ++++ T TP      T + 
Sbjct: 3106 --TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 3163

Query: 906  TLSWLSPPARWPPQPSSRPRPPAAPWAACRAWARPSACLCPRSAG---PSWAPATAATCC 1076
            T    +      P P+    P   P          +    P   G   P+  P T  T  
Sbjct: 3164 TPITTTTTVTPTPTPTGTQTPTTTP-----ITTTTTVTPTPTPTGTQTPTTTPITTTTTV 3218

Query: 1077 --PPSPLSTFTPSSTP 1118
               P+P  T TP++TP
Sbjct: 3219 TPTPTPTGTQTPTTTP 3234

 Score = 70.5 bits (171), Expect = 5e-11
 Identities = 88/374 (23%), Positives = 129/374 (33%), Gaps = 13/374 (3%)
 Frame = +3

Query: 36   SPWTTPPCTSPPTSRPSSQRLASLSPPTPARAAACWRASTRCTATSAPSRTSPPSTRWTC 215
            +P  TP  T  PT+ P +        PTP       +  T    T+  + T  P+   T 
Sbjct: 3886 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT----QTPTTTPITTTTTVTPTPTPTGTQ 3941

Query: 216  LNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAP---------PPPEPRTTAAAIC 368
               + P  T+    P  +P     P       TT   P         P   P TT   + 
Sbjct: 3942 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 4001

Query: 369  WPPPPDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPACSACRSWT 548
              P P    +P T+P   +T    + T  T   +PT          TTP    +   + T
Sbjct: 4002 PTPTPTGTQTPTTTPITTTTTVTPTPT-PTGTQTPT----------TTP---ITTTTTVT 4047

Query: 549  PAPAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSSTWAMSR 728
            P P P  +       +TPT TP+    T TPT     T        T  P T++T     
Sbjct: 4048 PTPTPTGT-------QTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVTP- 4094

Query: 729  RWARLPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPRWASCATWSR 905
                 P  + +  ++P     +  PTP+   T TP+T    ++++ T TP      T + 
Sbjct: 4095 --TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 4152

Query: 906  TLSWLSPPARWPPQPSSRPRPPAAPWAACRAWARPSACLCPRSAGPSWAPATAATCCPPS 1085
            T    +      P P+    P   P          +    P   G    P T  +  P +
Sbjct: 4153 TPITTTTTVTPTPTPTGTQTPTTTP-----ITTTTTVTPTPTPTGTQTGPPTHTSTAPIA 4207

Query: 1086 PLSTFTP---SSTP 1118
             L+T  P   SSTP
Sbjct: 4208 ELTTSNPPPESSTP 4221

 Score = 70.5 bits (171), Expect = 5e-11
 Identities = 87/374 (23%), Positives = 128/374 (33%), Gaps = 13/374 (3%)
 Frame = +3

Query: 36   SPWTTPPCTSPPTSRPSSQRLASLSPPTPARAAACWRASTRCTATSAPSRTSPPSTRWTC 215
            +P  TP  T  PT+ P +        PTP       +  T    T+  + T  P+   T 
Sbjct: 3863 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT----QTPTTTPITTTTTVTPTPTPTGTQ 3918

Query: 216  LNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAP---------PPPEPRTTAAAIC 368
               + P  T+    P  +P     P       TT   P         P   P TT   + 
Sbjct: 3919 TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT 3978

Query: 369  WPPPPDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPACSACRSWT 548
              P P    +P T+P   +T    + T  T   +PT          TTP    +   + T
Sbjct: 3979 PTPTPTGTQTPTTTPITTTTTVTPTPT-PTGTQTPT----------TTP---ITTTTTVT 4024

Query: 549  PAPAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSSTWAMSR 728
            P P P  +       +TPT TP+    T TPT     T        T  P T++T     
Sbjct: 4025 PTPTPTGT-------QTPTTTPITTTTTVTPTPTPTGTQT-----PTTTPITTTTTVTP- 4071

Query: 729  RWARLPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T-TPRWASCATWSR 905
                 P  + +  ++P     +  PTP+   T TP+T    ++++ T TP      T + 
Sbjct: 4072 --TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT 4129

Query: 906  TLSWLSPPARWPPQPSSRPRPPAAPWAACRAWARPSACLCPRSAG---PSWAPATAATCC 1076
            T    +      P P+    P   P          +    P   G   P+  P T  T  
Sbjct: 4130 TPITTTTTVTPTPTPTGTQTPTTTP-----ITTTTTVTPTPTPTGTQTPTTTPITTTTTV 4184

Query: 1077 PPSPLSTFTPSSTP 1118
             P+P  T T +  P
Sbjct: 4185 TPTPTPTGTQTGPP 4198

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 100/411 (24%), Positives = 142/411 (34%), Gaps = 44/411 (10%)
 Frame = +3

Query: 18   SPPPAPS----PWTTPPCTS---PPTSRPSSQRLASLSPPTPARAAACWRASTRCTATSA 176
            +P P P+    P TTP  T+    PT  P+  +  + +P T          +T  T T  
Sbjct: 4093 TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT---------TTTTVTPTPT 4143

Query: 177  PSRTSPPSTRWTCLNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAPPPPEPRTTA 356
            P+ T  P+T         P  T+    P  +P     P   T + TT    P P P  T 
Sbjct: 4144 PTGTQTPTT--------TPITTTTTVTPTPTPTGTQTPTT-TPITTTTTVTPTPTPTGTQ 4194

Query: 357  AAICWPPPPDPACSP----WTSPAPP--STLRLASATWSTAAASPTWAS*FAPC--RRTT 512
                  PP   + +P     TS  PP  ST + + +T S    S T  S   P     +T
Sbjct: 4195 TG----PPTHTSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEMTST 4250

Query: 513  PPPACSACRSWTPAPAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATC 692
             PP+       TP      SG   HTL  P  T    +   TPTR   +  +S    +T 
Sbjct: 4251 APPS-------TPTAPTTTSG--GHTLSPPPST--TTSPPGTPTRGTTTGSSSAPTPSTV 4299

Query: 693  RPPTSSTWAMSRRWARLPATSP-STPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS*T 869
            +  T+S W         P  +P STPS  R       P+   +      T  +P      
Sbjct: 4300 QTTTTSAWT--------PTPTPLSTPSIIRTTGLRPYPSSVLICCVLNDTYYAPGEEVYN 4351

Query: 870  TPRWASCATWSRTLS-------WLSP----PARWPPQPSSRPRPPAAPWAACRAWARPSA 1016
                 +C   + +LS       W  P    P   P + +  P  P++  +      +P  
Sbjct: 4352 GTYGDTCYFVNCSLSCTLEFYNWSCPSTPSPTPTPSKSTPTPSKPSSTPSKPTPGTKPPE 4411

Query: 1017 CL---CPRSAGPSW--APATAATC------------CPPSPLSTFTPSSTP 1118
            C     PR    +W       ATC            C P P+ T +    P
Sbjct: 4412 CPDFDPPRQENETWWLCDCFMATCKYNNTVEIVKVECEPPPMPTCSNGLQP 4462

 Score = 52.4 bits (124), Expect = 1e-05
 Identities = 78/313 (24%), Positives = 104/313 (32%), Gaps = 32/313 (10%)
 Frame = +3

Query: 15   SSPPPAPSPWTTPPCTSPPTSRPSSQRLASLSPPTPARAAACWRASTRCTATSAPSRTSP 194
            ++ P   +   TP  T   T  P++  + + +  TP       +  T    T+  + T  
Sbjct: 4105 TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT 4164

Query: 195  PSTRWTCLNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAP-----PPPEPRTTAA 359
            P+   T    + P  T+    P  +P      PP T   T P A      PPPE  T   
Sbjct: 4165 PTPTGTQTPTTTPITTTTTVTPTPTPTGTQTGPP-THTSTAPIAELTTSNPPPESSTPQT 4223

Query: 360  AICWPPPPD---------PACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTT 512
            +     P           P     TS APPST    + T      SP       P   T+
Sbjct: 4224 SRSTSSPLTESTTLLSTLPPAIEMTSTAPPSTPTAPTTTSGGHTLSP------PPSTTTS 4277

Query: 513  PP--PACSACRSWTPAPAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCA 686
            PP  P        + AP P        +  TPT TPL   +    T  R    +   CC 
Sbjct: 4278 PPGTPTRGTTTGSSSAPTPSTVQTTTTSAWTPTPTPLSTPSIIRTTGLRPYPSSVLICCV 4337

Query: 687  ---TCRPPTSSTW-------------AMSRRWARLPATSPSTPSSPRRCRASRAPTPSAL 818
               T   P    +             ++S        + PSTPS          PTPS  
Sbjct: 4338 LNDTYYAPGEEVYNGTYGDTCYFVNCSLSCTLEFYNWSCPSTPSP--------TPTPSK- 4388

Query: 819  STGTPSTASSPSS 857
            ST TPS  SS  S
Sbjct: 4389 STPTPSKPSSTPS 4401

 Score = 34.3 bits (77), Expect = 4.0
 Identities = 27/102 (26%), Positives = 34/102 (32%), Gaps = 12/102 (11%)
 Frame = +3

Query: 9    CASSPPPAPSPWTTPPCTSPPTSRPSSQRLASLSP-----PTPARAAACWRASTRCTATS 173
            C S+P P P+P  + P  S P+S PS     +  P       P +    W       AT 
Sbjct: 4376 CPSTPSPTPTPSKSTPTPSKPSSTPSKPTPGTKPPECPDFDPPRQENETWWLCDCFMATC 4435

Query: 174  APSRT-------SPPSTRWTCLNPSCPARTSPCSWPCWSPAC 278
              + T         P    TC N   P R       CW   C
Sbjct: 4436 KYNNTVEIVKVECEPPPMPTCSNGLQPVRVEDPDGCCWHWEC 4477

>gb|AAA59875.1| mucin
          Length = 573

 Score =  112 bits (281), Expect = 9e-24
 Identities = 115/398 (28%), Positives = 152/398 (37%), Gaps = 28/398 (7%)
 Frame = +3

Query: 9    CASSPPP---APSPWTTPPCTSPPTSRPSSQRLASLSPPTPARAAACWRASTRCTATSAP 179
            C ++P P    PSP  T   T PPT+ PS     + +PP     +     +T    T+ P
Sbjct: 53   CITTPSPPTTTPSPPPTSTTTLPPTTTPSPPTTTTTTPPPTTTPSPPITTTTTPPPTTTP 112

Query: 180  S-----RTSPPSTRWTCLNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAPP---- 332
            S      T+PP T  T  +P     + P + P         PPP     TT P+PP    
Sbjct: 113  SPPISTTTTPPPT--TTPSPPTTTPSPPTTTPSPPTTTTTTPPP-----TTTPSPPTTTP 165

Query: 333  --PPEPRTTAAAICWPPPPDPACS---PWTSPAPPSTLRLASATWSTAAASPTWAS*FAP 497
              PP   TT      P PP    +   P T+P+PP+T  +   T ST    PT      P
Sbjct: 166  ITPPASTTTLPPTTTPSPPTTTTTTPPPTTTPSPPTTTPITPPT-STTTLPPTTTPSPPP 224

Query: 498  CRRTTPPPACSACRSWTPAPAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCR 677
               TTPPP  +     T  P+P        T  TP  T      T T T    +T  S  
Sbjct: 225  TTTTTPPPTTTPSPPTTTTPSP-----PTITTTTPPPTTTPSPPTTTTTTPPPTTTPSPP 279

Query: 678  CCATCRPPTSSTWAMSRRWARLPATSPST--PSSPRRCRASRAPTPSALSTGTPSTASSP 851
                  PPTS+T          P T+ +T  P++      +  P+P   +T TP   ++P
Sbjct: 280  TTTPITPPTSTTTLPPTTTPSPPPTTTTTPPPTTTPSPPTTTTPSPPITTTTTPPPTTTP 339

Query: 852  SSSS*TTPR--WASCATWSRTLSWLSP-PARWPPQPSSRPRPPAAPWAACRAWARPSACL 1022
            SS   TTP     +  T S T +  SP      P  ++ P PP            P+   
Sbjct: 340  SSPITTTPSPPTTTMTTPSPTTTPSSPITTTTTPSSTTTPSPP------------PTTMT 387

Query: 1023 CPRSAGPSWAPATAATCCPP----SPLST--FTPSSTP 1118
             P        P T  T  PP    SPL+T    PS TP
Sbjct: 388  TPSPTTTPSPPTTTMTTLPPTTTSSPLTTTPLPPSITP 425

 Score =  104 bits (260), Expect = 2e-21
 Identities = 118/406 (29%), Positives = 161/406 (39%), Gaps = 47/406 (11%)
 Frame = +3

Query: 15   SSPPPA--PSPWTTPPCTSPPTSRPSSQRLASLSPP---TPARAAACWRASTRCTATSAP 179
            ++PPP   PSP TT P  SPPT+ PS     + +PP   TP+            T T  P
Sbjct: 120  TTPPPTTTPSPPTTTP--SPPTTTPSPPTTTTTTPPPTTTPSPPTTTPITPPASTTTLPP 177

Query: 180  SRT-SPPSTRWTCLNPSC---PARTSPCSWPCWS----PACCPVPPPWTAVCTTPPAPP- 332
            + T SPP+T  T   P+    P  T+P + P  +    P   P PPP T   TTPP  P 
Sbjct: 178  TTTPSPPTTTTTTPPPTTTPSPPTTTPITPPTSTTTLPPTTTPSPPPTTT--TTPP--PT 233

Query: 333  -PPEPRTTAA------AICWPPP---PDPACS------PWTSPAPPSTLRLASATWSTAA 464
              P P TT            PPP   P P  +      P T+P+PP+T  +   T ST  
Sbjct: 234  TTPSPPTTTTPSPPTITTTTPPPTTTPSPPTTTTTTPPPTTTPSPPTTTPITPPT-STTT 292

Query: 465  ASPTWAS*FAPCRRTTPPPACSACRSWTPAPAPFRSGRRRHTLRTPTWTPLMCAATATPT 644
              PT      P   TTPPP  +     T  P+P                P+    T  PT
Sbjct: 293  LPPTTTPSPPPTTTTTPPPTTTPSPPTTTTPSP----------------PITTTTTPPPT 336

Query: 645  RCRASTWNSCRCCATCRPPTSSTWAMSRRWARLPATSPSTPSSPRRCRASR---APTPSA 815
                 T  S     T  PPT++    S      P T+PS+P +     +S    +P P+ 
Sbjct: 337  -----TTPSSPITTTPSPPTTTMTTPS------PTTTPSSPITTTTTPSSTTTPSPPPTT 385

Query: 816  LSTGTPSTASSPSSSS*TT--PRWASCATWSRTLSWLSPPARWPPQPSSRPRPPAAPWAA 989
            ++T +P+T  SP +++ TT  P   S    +  L     P  + P  ++ P  P  P   
Sbjct: 386  MTTPSPTTTPSPPTTTMTTLPPTTTSSPLTTTPLPPSITPPTFSPFSTTTPTTPCVPLCN 445

Query: 990  CRAW---ARPS-------ACLCPRSAGPSWAP--ATAATCCPPSPL 1091
               W    +P+         L     GP WA   +  AT  P  P+
Sbjct: 446  WTGWLDSGKPNFHKPGGDTELIGDVCGPGWAANISCRATMYPDVPI 491

 Score = 97.8 bits (242), Expect = 3e-19
 Identities = 98/338 (28%), Positives = 126/338 (36%), Gaps = 10/338 (2%)
 Frame = +3

Query: 126  RAAACWRASTRCTATSAPSRT-SPPSTRWTCL----NPSCPARTSPCSWPCWSPACCPVP 290
            R   CW      T  S P+ T SPP T  T L     PS P  T+    P  +P+     
Sbjct: 43   RVNCCWPMDKCITTPSPPTTTPSPPPTSTTTLPPTTTPSPPTTTTTTPPPTTTPS----- 97

Query: 291  PPWTAVCTTPPAPPPPEPRTTAAAICWPPPPDPACSPWTSPAPPSTLRLASATWSTAAAS 470
            PP T   T PP   P  P +T      PPP      P T+P+PP+T      T +T    
Sbjct: 98   PPITTTTTPPPTTTPSPPISTTTT---PPPTTTPSPPTTTPSPPTTTPSPPTTTTTTPPP 154

Query: 471  PTWAS*FAPCRRTTPPPACSACRSWTPAPAPFRSGRRRHTLRTPTWTPLMCAATATPTRC 650
             T  S   P      PPA +     T  P+P  +     T  TP  T      T TP   
Sbjct: 155  TTTPS--PPTTTPITPPASTTTLPPTTTPSPPTT-----TTTTPPPTTTPSPPTTTPITP 207

Query: 651  RASTWNSCRCCATCRPPTSSTWAMSRRWARLPATSPSTPSSPRRCRASRAPTPSALSTGT 830
              ST           PPT++T          P T+PS P+       +  P+P  ++T T
Sbjct: 208  PTSTTTLPPTTTPSPPPTTTT-------TPPPTTTPSPPT-------TTTPSPPTITTTT 253

Query: 831  --PSTASSPSSSS*TTPRWASCATWSRTLSWLSPPARWPPQPSSRPRPPAAPWAACRAWA 1004
              P+T  SP +++ TTP                PP   P  P++ P  P           
Sbjct: 254  PPPTTTPSPPTTTTTTP----------------PPTTTPSPPTTTPITPPT--------- 288

Query: 1005 RPSACLCPRSAGPSWAPATAATCCP---PSPLSTFTPS 1109
              S    P +  PS  P T  T  P   PSP +T TPS
Sbjct: 289  --STTTLPPTTTPSPPPTTTTTPPPTTTPSPPTTTTPS 324

 Score = 61.6 bits (148), Expect = 2e-08
 Identities = 57/187 (30%), Positives = 73/187 (38%), Gaps = 5/187 (2%)
 Frame = +3

Query: 3   PWCASSPPPAPSPWTTPPCT--SPPTSRPSSQRLASLSPPTPARAAACWRASTRCTATSA 176
           P    SPPP  +  T PP T  SPPT+   S  + + + P P             T  S+
Sbjct: 295 PTTTPSPPPTTT-TTPPPTTTPSPPTTTTPSPPITTTTTPPPT------------TTPSS 341

Query: 177 PSRT--SPPSTRWTCLNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAPPPPEPRT 350
           P  T  SPP+T  T  +P+    +   +    S    P PPP T    +P   P P P T
Sbjct: 342 PITTTPSPPTTTMTTPSPTTTPSSPITTTTTPSSTTTPSPPPTTMTTPSPTTTPSP-PTT 400

Query: 351 TAAAICWPPPPDPACSP-WTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPAC 527
           T   +    PP    SP  T+P PPS               PT    F+P   TTP   C
Sbjct: 401 TMTTL----PPTTTSSPLTTTPLPPS------------ITPPT----FSPFSTTTPTTPC 440

Query: 528 SACRSWT 548
               +WT
Sbjct: 441 VPLCNWT 447

>ref|NP_767161.1| blr0521 [Bradyrhizobium japonicum] gi|27348769|dbj|BAC45786.1|
            blr0521 [Bradyrhizobium japonicum USDA 110]
          Length = 745

 Score =  103 bits (258), Expect = 4e-21
 Identities = 117/388 (30%), Positives = 144/388 (36%), Gaps = 20/388 (5%)
 Frame = +3

Query: 15   SSPPPAPSPWTTPPCTSPPTSRPSSQRLASLSPPTPARAAACWRASTRCTATSAPSRTSP 194
            ++PPPA +P   PP   PP + P         PP PA   A           +AP + SP
Sbjct: 68   AAPPPAAAP-PHPPAAPPPAAAPPRPAAPPPPPPPPAARPA---PPPPPPPPAAPKQPSP 123

Query: 195  PSTRWTCLNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAPPPPEPRTTAAAICWP 374
            P         + P + +P   P   PA  P P        TPPAPPP      A     P
Sbjct: 124  PPA-------AAPQQHAPTPPPPAPPAARPAP--------TPPAPPPAAAPQHAP----P 164

Query: 375  PPPDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRRTTPPPACSACRSWTPA 554
            PPP PA  P  +P PP     A+       A+PT            PPPA    R  +PA
Sbjct: 165  PPPPPAARPTPTPPPPPPAGPAARPTPAPTATPT---------PVAPPPAAPTARPGSPA 215

Query: 555  PAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCATCRPPTSSTWAMSRRW 734
            PA            TP  TP     T  PT   A T           PP        R  
Sbjct: 216  PA-----------ATPAPTP-----TPAPTATPAPTATPAPGSTPGAPPA------GRPG 253

Query: 735  ARLPATSPSTP---SSPRRCRASRAPT----PSALST---GTPSTASSPSSSS*TTPRWA 884
            A  P   P +P    SP    A+ APT    P   +T   G P  AS+P+  +  TP  A
Sbjct: 254  APPPGVRPGSPPAAGSPPAPGATPAPTTTPAPGGTATPPSGRPGPASTPAPGA-ATP--A 310

Query: 885  SCATWSRTLSWLSPPARWPPQPSSRPR---PPAAPWAACRAWARPSACLCPR-------S 1034
              AT +   +   PP R    P+  P+   PPA   AA    A P A   P        +
Sbjct: 311  PTATPAPGGALTPPPGRPGAGPTPGPQGGTPPAGAPAAGTPAAPPQAGGLPARPAAPAGA 370

Query: 1035 AGPSWAPATAATCCPPSPLSTFTPSSTP 1118
            A PS  P +AA   PP+      P+ TP
Sbjct: 371  AAPSTVPGSAAATPPPNRAQFAPPTVTP 398

 Score = 91.3 bits (225), Expect = 3e-17
 Identities = 98/330 (29%), Positives = 122/330 (36%), Gaps = 6/330 (1%)
 Frame = +3

Query: 147  ASTRCTATSAPSRTSPPSTRWTCLNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPA 326
            AS    A + P  T P         P  P +  P + P  +PA    PPP  A    PPA
Sbjct: 29   ASPLVVAQAQPQETGPDG------KPKQPPKGPPGAAPPAAPARPAAPPP-AAAPPHPPA 81

Query: 327  PPPPEPRTTAAAICWPPPPDPACSPWTSPAPPSTLRLASATWSTAAASPTWAS*FAPCRR 506
             PPP       A   PPPP PA  P   P PP        +   AAA    A        
Sbjct: 82   APPPAAAPPRPAAPPPPPPPPAARPAPPPPPPPPAAPKQPSPPPAAAPQQHAP------- 134

Query: 507  TTPPPACSACRSWTPAPAPFRSGRRRHTLRTPTWTPLMCAATATPTRCRASTWNSCRCCA 686
            T PPPA  A R     PAP  +   +H    P   P     T TP     +         
Sbjct: 135  TPPPPAPPAARPAPTPPAPPPAAAPQHA--PPPPPPPAARPTPTPPPPPPA--------G 184

Query: 687  TCRPPTSSTWAMSRRWARLPATSPSTPSSPRRCRASRAPTPSALSTGTPSTASSPSSSS* 866
                PT +  A     A  PA   + P SP    A+ APTP+   T TP+  ++P+  S 
Sbjct: 185  PAARPTPAPTATPTPVAPPPAAPTARPGSPAPA-ATPAPTPTPAPTATPAPTATPAPGS- 242

Query: 867  TTPRWASCATWSRTLSWLSPPARWP--PQPSSRPRPPAAPWAACRAWARPSACLCPRSAG 1040
             TP               +PPA  P  P P  RP  P A  +     A P+    P   G
Sbjct: 243  -TPG--------------APPAGRPGAPPPGVRPGSPPAAGSPPAPGATPAPTTTPAPGG 287

Query: 1041 ----PSWAPATAATCCPPSPLSTFTPSSTP 1118
                PS  P  A+T  P +  +T  P++TP
Sbjct: 288  TATPPSGRPGPASTPAPGA--ATPAPTATP 315

 Score = 66.6 bits (161), Expect = 7e-10
 Identities = 83/293 (28%), Positives = 100/293 (33%), Gaps = 16/293 (5%)
 Frame = +3

Query: 12  ASSPPPAPSPWTTPPCTSP--PTSRPSSQRLASLSPPTPARAAACWRASTRCTATSAPSR 185
           A+ P PAP+   TP    P  PT+RP S   A+   PTP  A          TAT AP+ 
Sbjct: 186 AARPTPAPTATPTPVAPPPAAPTARPGSPAPAATPAPTPTPAP---------TATPAPTA 236

Query: 186 TSPPSTRWTCLNPSCPARTSPCSWPCWSPACCPVPPPWTAVCTTPPAPPPPEPRTTAAAI 365
           T  P +      P  P    P             PPP     + P A  PP P  T A  
Sbjct: 237 TPAPGS-----TPGAPPAGRP-----------GAPPPGVRPGSPPAAGSPPAPGATPAPT 280

Query: 366 CWPPPPDPACSPWTSPAPPSTLRLASATWS-TAAASPTWAS*FAPCRRTTPP-------- 518
             P P   A  P   P P ST    +AT + TA  +P  A    P R    P        
Sbjct: 281 TTPAPGGTATPPSGRPGPASTPAPGAATPAPTATPAPGGALTPPPGRPGAGPTPGPQGGT 340

Query: 519 PACSACRSWTPAPAPFRSGRRRHT-----LRTPTWTPLMCAATATPTRCRASTWNSCRCC 683
           P   A  + TPA  P   G             P+  P   AAT  P R            
Sbjct: 341 PPAGAPAAGTPAAPPQAGGLPARPAAPAGAAAPSTVPGSAAATPPPNR------------ 388

Query: 684 ATCRPPTSSTWAMSRRWARLPATSPSTPSSPRRCRASRAPTPSALSTGTPSTA 842
           A   PPT     ++  +   P      P  PR     R  TP A+  G  + A
Sbjct: 389 AQFAPPT-----VTPAFQAAPTVVAPLPPPPR--PPQRDLTPLAIGAGVVAGA 434



EST assemble image


clone accession position
1 HCL086h02_r AV644349 1 470
2 HCL036h12_r AV641590 130 665
3 CL29h08_r AV394633 426 926
4 HCL060g09_r AV642933 594 1118




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research