KCC000442A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000442A_C01 KCC000442A_c01
CAAAATGGCACTGCATGCGACTGGGCCTGCCGCGACCGGCACCACCCGGGGTGCGAGTGC
TCGCGCCTCGCGCTCGGGCTATGTCTCTGCTCCCAGGTCACGGAGGGCGACGCCCGTCCG
TGCTTCTGCTACGGAGACCAAGGCTACGGAGCAGCCGAAGGGCACGGTCAGCCTTGGCTG
CCCTGTTCGGCGGCCTGCCCAAGCTGGGCGTGACCGGCACTGTGCAGCTGGGCAATAAGA
AGAAGGAGGAGAAGAAGGGGCCCGCCGCGCGGGGCGGCCGCGATGACAGCGTGGTGTTCG
TGGCTGGCTCCACGGGCCGCACCGGCGCCCGCGTCGTCAGGGAGCTGCTGGCTGCCGGCT
TCACGGTCCGCGCCGGCGCCCGCAACGTGGAGGCGGCGGAGGCGGCGC


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000442A_C01 KCC000442A_c01
         (408 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

emb|CAC87810.2| Tic62 protein [Pisum sativum]                          62  1e-09
dbj|BAB03098.1| gb|AAC26697.1~gene_id:MCB22.6~similar to unknown...    51  3e-06
ref|NP_188519.2| expressed protein [Arabidopsis thaliana] gi|250...    51  3e-06
gb|AAL73559.1|AC079632_3 Unknown protein [Oryza sativa] gi|19920...    50  7e-06
ref|NP_565789.2| flavin reductase-related [Arabidopsis thaliana]...    50  1e-05

>emb|CAC87810.2| Tic62 protein [Pisum sativum]
          Length = 534

 Score = 62.4 bits (150), Expect = 1e-09
 Identities = 38/102 (37%), Positives = 51/102 (49%)
 Frame = +3

Query: 99  HGGRRPSVLLLRRPRLRSSRRARSALAALFGGLPKLGVTGTVQLGNKKKEEKKGPAARGG 278
           H  R P    L   R+RSS  + S++ A   G  K      +            P     
Sbjct: 38  HFMRYPLTTTLTNNRIRSSSSSSSSIRAQASGSTKSSTAEGI------------PEKTDS 85

Query: 279 RDDSVVFVAGSTGRTGARVVRELLAAGFTVRAGARNVEAAEA 404
           +DD++VFVAG+TG+ G+R VREL+  GF VRAG RN + A A
Sbjct: 86  KDDNLVFVAGATGKVGSRTVRELIKLGFKVRAGVRNAQKAGA 127

>dbj|BAB03098.1| gb|AAC26697.1~gene_id:MCB22.6~similar to unknown protein
           [Arabidopsis thaliana]
          Length = 649

 Score = 51.2 bits (121), Expect = 3e-06
 Identities = 23/46 (50%), Positives = 32/46 (69%)
 Frame = +3

Query: 261 PAARGGRDDSVVFVAGSTGRTGARVVRELLAAGFTVRAGARNVEAA 398
           P     +++ +VFVAG+TG+ G+R VRELL  GF VRAG R+ + A
Sbjct: 73  PTNLNSKEEDLVFVAGATGKVGSRTVRELLKLGFRVRAGVRSAQRA 118

>ref|NP_188519.2| expressed protein [Arabidopsis thaliana] gi|25083201|gb|AAN72050.1|
           Unknown protein [Arabidopsis thaliana]
           gi|30725480|gb|AAP37762.1| At3g18890 [Arabidopsis
           thaliana]
          Length = 641

 Score = 51.2 bits (121), Expect = 3e-06
 Identities = 23/46 (50%), Positives = 32/46 (69%)
 Frame = +3

Query: 261 PAARGGRDDSVVFVAGSTGRTGARVVRELLAAGFTVRAGARNVEAA 398
           P     +++ +VFVAG+TG+ G+R VRELL  GF VRAG R+ + A
Sbjct: 73  PTNLNSKEEDLVFVAGATGKVGSRTVRELLKLGFRVRAGVRSAQRA 118

>gb|AAL73559.1|AC079632_3 Unknown protein [Oryza sativa]
           gi|19920208|gb|AAM08640.1|AC108883_13 Putative
           dehydrogenase [Oryza sativa] gi|31429731|gb|AAP51740.1|
           putative dehydrogenase [Oryza sativa (japonica
           cultivar-group)]
          Length = 355

 Score = 50.1 bits (118), Expect = 7e-06
 Identities = 20/48 (41%), Positives = 34/48 (70%)
 Frame = +3

Query: 261 PAARGGRDDSVVFVAGSTGRTGARVVRELLAAGFTVRAGARNVEAAEA 404
           P ++  +++ +VF+AG+TG+ G+R VRE +  GF VRAG R+ + A +
Sbjct: 64  PESKSTKENDLVFIAGATGKVGSRAVREFIKLGFRVRAGVRSAQRASS 111

>ref|NP_565789.2| flavin reductase-related [Arabidopsis thaliana]
           gi|7485472|pir||T02333 hypothetical protein At2g34460
           [imported] - Arabidopsis thaliana
           gi|24030209|gb|AAN41284.1| unknown protein [Arabidopsis
           thaliana]
          Length = 280

 Score = 49.7 bits (117), Expect = 1e-05
 Identities = 22/38 (57%), Positives = 31/38 (80%)
 Frame = +3

Query: 294 VFVAGSTGRTGARVVRELLAAGFTVRAGARNVEAAEAA 407
           VFVAG+TG+TG R+V +LL+ GF V+AG R+VE A+ +
Sbjct: 49  VFVAGATGQTGKRIVEQLLSRGFAVKAGVRDVEKAKTS 86



EST assemble image


clone accession position
1 HCL027h10_r AV641110 1 367
2 HCL046g06_r AV642169 11 212
3 HCL100f12_r AV645291 11 431
4 CL29g09_r AV394670 16 280




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research