KCC000441A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000441A_C01 KCC000441A_c01
gccgtacatgcagtacaacggcagcagccagggcgtcatctttgagccctccaccatccg
cgccttcgaccgcaaccCGGCGCTGGTGGACAACGCAGACCATGGCCAAGGCTGCTCACG
CTGTACTCGGCGCTCATCGGCCTGTCACCCATGGACTACAAGGTGGAGGACAAGTGCGAC
GTGGTGGGCGCGGCGCCGGCGGACGCGGGCCGAGCCATGGCGCAGCGCTTCGCCAACGGC
ACCTGCCTCATGGGCGTGGGGCTGGGAGACTTCTTCAAGGCGTTCAAGACGTCGCCCTTC
CGCGGCAAGCTGGGCGTGGCGCTCATGCCCGGCTCCTTCGAGGTCCTCAACCGCACCTCC
AACCAGCTGGTGCCCTGTGCCGCCGACACCTGCCCCTTCGGCACCGTGGTACCCGCCCAG
CCCGGGCCGTCGGCCTCGGACGGCGGCCCTAGCATTACGCGTGTGCTCAACCGCGCGCCC
TTCGCGGCCGGCGGCGGTTGGGTAGCGGCGGTGAACGCGCGCACGCCCAACGACTACCGC
AACTACTCCATCGGCTTCTTCTCGCACCTGGCCAGCCCCGCCGAGTCGTGGCAGCGCGTG
CTGCTGCCCGAGAGCTCCTTCGACCCGTACCGCCTGGAGCACTTCTCCAACCTGGCCCGC
TGGAACGAGTCGGGCTACGAGCCGGCCGACACCGCCGCCTATCTGGCCCATGCCAACGAG
TCCTTCAGCCACCCCAACATCGTGCTGGACCTGCGCACGCCCGGCACCAAGCTGTTCAGG
GACATCTATGAGAGCGGCCTGGCCAACCTGACCACCGGCAGCAGCGTGGACAGCGTGGTG
GCGCTCATGAACCAGACCTTCTACAAGCTGCTGCTGGACCCGCAGCAGAAGCAGTTCCGC
TCGCTGCTGGCCGACACCTACCTCGCCACCATCAACTACAATAACATCCAGAACCTGAAC
GGCACCGCCGGCGGCGACGGCGGCGGCGGCGGCGGCTCGCCGTCGTGGCTGCCCATCGCC
ATTGTGCTGCCCACCGTGGGCGCGTTGCTGCTCATTGCGGCTGGTGTTGTGTATGAGGTG
CGCAACAACCGCAAGCACAAGAACCTGTTCGGCAAGGTGGTGCCGCCCGGCGTGGGCCCC
GACACCACCATCCTGGTCACCGAGATCCAGGACTACAACCAGATTGTGGACGCGCTCTCC
AGCGAGGCAGTGGACCGGCTGCTCAAGGACCACAACGACTGCCTGCGCCGCCTGCTGCTG
CGCCACAGCGGCTATG


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000441A_C01 KCC000441A_c01
         (1276 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|ZP_00056820.1| COG2115: Xylose isomerase [Thermobifida fusca]      82  2e-14
ref|XP_318717.1| ENSANGP00000004655 [Anopheles gambiae] gi|30174...    81  3e-14
dbj|BAC87637.1| unnamed protein product [Homo sapiens]                 79  1e-13
gb|AAK31375.1|AC084329_1 ppg3 [Leishmania major]                       79  2e-13
gb|AAA59163.1| mucin                                                   78  4e-13

>ref|ZP_00056820.1| COG2115: Xylose isomerase [Thermobifida fusca]
          Length = 754

 Score = 82.0 bits (201), Expect = 2e-14
 Identities = 78/268 (29%), Positives = 105/268 (39%), Gaps = 2/268 (0%)
 Frame = +2

Query: 224  SASPTAPASWAWGWETSSRRSRRRPSAASWAWRSCPAPSRSSTA--PPTSWCPVPPTPAP 397
            +A+P APA+       +       PSAA+ A R  P P +SS A  PP S       PAP
Sbjct: 61   AATPPAPATTTPPPTPTGPTCSPSPSAANSAPRESPPPPKSSAASPPPNSPPSTSSAPAP 120

Query: 398  SAPWYPPSPGRRPRTAALALRVCSTARPSRPAAVG*RR*TRARPTTTATTPSASSRTWPA 577
            +  W P SP     T   A     +A P  P+           P     TP A S   P 
Sbjct: 121  ATTWPPHSPS----TPDPATSSSPSAPPEPPS---------PSPKNPPPTPPAPSPDSPT 167

Query: 578  PPSRGSACCCPRAPSTRTAWSTSPTWPAGTSRATSRPTPPPIWPMPTSPSATPTSCWTCA 757
            PP   S      APST+ A S      + +    S  +P P  P P + S+ PTS     
Sbjct: 168  PPDASSP---SSAPSTQPASSPPEPLRSASPSKNSTNSPSPHPPAPAASSSCPTSTANAP 224

Query: 758  RPAPSCSGTSMRAAWPT*PPAAAWTAWWRS*TRPSTSCCWTRSRSSSARCWPTPTSPPST 937
               P+    S  +  PT PP   W A       PS+  C   S + S    P+ T    +
Sbjct: 225  PTCPTPPAASTASPEPTSPP-PTWPA-------PSSKACSAASLTPST---PSSTKVSPS 273

Query: 938  TITSRT*TAPPAATAAAAAARRRGCPSP 1021
            T++S +  AP    +A +  +    PSP
Sbjct: 274  TVSSSSAAAPAPPQSAPSPPKSSAAPSP 301

 Score = 65.5 bits (158), Expect = 2e-09
 Identities = 96/353 (27%), Positives = 140/353 (39%), Gaps = 23/353 (6%)
 Frame = +2

Query: 221  RSASPTAPASWAWGWETSSRRSRRRPSAASW-------AWRSCPAPSRSSTAPPTSWCPV 379
            +S SP +P+  + G   ++  +   P A+S        A    P PS ++  PP      
Sbjct: 12   QSPSPASPSPNSAGSPNTNPTTPPEPKASSCPTTGSPNALPKPPNPSPTAATPPAPATTT 71

Query: 380  PPTPAPSAPWYPPSP---GRRPRTAALALRVCSTARP--SRPAAVG*RR*TRARPTTTAT 544
            PP P P+ P   PSP      PR +    +  + + P  S P+       T + P    T
Sbjct: 72   PP-PTPTGPTCSPSPSAANSAPRESPPPPKSSAASPPPNSPPS-------TSSAPAPATT 123

Query: 545  TPSASSRTWPAPPSRGSACCCPRAPSTRTAWSTSPTWPAGTSRATSRPTPPPIWPMPTSP 724
             P  S  T P P +  S    P  P      S SP  P  T  A S  +P P  P  +SP
Sbjct: 124  WPPHSPST-PDPATSSSPSAPPEPP------SPSPKNPPPTPPAPSPDSPTP--PDASSP 174

Query: 725  SATPTSCWTCARPAP----SCSGTSMRAAWPT*PPAAAWTAWWRS*TRPSTSCCWTRSRS 892
            S+ P++    + P P    S S  S  +  P  PPA A ++   + T  +   C T   +
Sbjct: 175  SSAPSTQPASSPPEPLRSASPSKNSTNSPSPH-PPAPAASSSCPTSTANAPPTCPTPPAA 233

Query: 893  SSARCWPTPTSPPSTTITSRT*TAPPAATAAAAAARRRGCPSPLCCPPWARCCSLRLVLC 1072
            S+A   P PTSPP T          P++ A +AA+     PS     P            
Sbjct: 234  STAS--PEPTSPPPT-------WPAPSSKACSAASLTPSTPSSTKVSP------------ 272

Query: 1073 MRCATTASTRTCSARWCRPAWAPTPPSWS-------PRSRTTTRLWTRSPARQ 1210
                +T S+ + +A    P  AP+PP  S       P++ T+    T  PA+Q
Sbjct: 273  ----STVSSSSAAAP-APPQSAPSPPKSSAAPSPSQPKANTSP---TAPPAKQ 317

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 65/236 (27%), Positives = 91/236 (38%), Gaps = 13/236 (5%)
 Frame = +2

Query: 149 PWTTRWRTSATWWARRRRTRAEPWRSASPTAPASWAWGWETSSRRSRRRPSAASWAWRSC 328
           P T+     AT W     +  +P  S+SP+AP         S +     P A S    + 
Sbjct: 112 PSTSSAPAPATTWPPHSPSTPDPATSSSPSAPPEPP---SPSPKNPPPTPPAPSPDSPTP 168

Query: 329 PAPSRSSTAPPTSWCPVPPTPAPSAPW----------YPPSPGRR---PRTAALALRVCS 469
           P  S  S+AP T     PP P  SA            +PP+P      P + A A   C 
Sbjct: 169 PDASSPSSAPSTQPASSPPEPLRSASPSKNSTNSPSPHPPAPAASSSCPTSTANAPPTC- 227

Query: 470 TARPSRPAAVG*RR*TRARPTTTATTPSASSRTWPAPPSRGSACCCPRAPSTRTAWSTSP 649
              P+ PAA           +T +  P++   TWPAP S+  +      PST ++   SP
Sbjct: 228 ---PTPPAA-----------STASPEPTSPPPTWPAPSSKACSAAS-LTPSTPSSTKVSP 272

Query: 650 TWPAGTSRATSRPTPPPIWPMPTSPSATPTSCWTCARPAPSCSGTSMRAAWPT*PP 817
           +  + +S A   P PP   P P   SA P+     A  +P+          P  PP
Sbjct: 273 STVSSSSAAA--PAPPQSAPSPPKSSAAPSPSQPKANTSPTAPPAKQPGHSPANPP 326

 Score = 62.0 bits (149), Expect = 2e-08
 Identities = 68/232 (29%), Positives = 96/232 (41%), Gaps = 21/232 (9%)
 Frame = +2

Query: 212 EPWRSASPTAPASWAWGWETSSRRSRRRPSAASWAWRSCPAPSRSSTAPPTSWCPVPPTP 391
           EP RSASP+          +++  S   P+ A+    S   P+ ++ APPT  CP PP  
Sbjct: 188 EPLRSASPSK--------NSTNSPSPHPPAPAA----SSSCPTSTANAPPT--CPTPPAA 233

Query: 392 APSAPWYPPSPGRRPRTAALALRVCSTAR--PSRPAAVG*RR*TRARPTTTATTPSASS- 562
           + ++P  P SP   P   A + + CS A   PS P++      T+  P+T +++ +A+  
Sbjct: 234 STASP-EPTSPP--PTWPAPSSKACSAASLTPSTPSS------TKVSPSTVSSSSAAAPA 284

Query: 563 --RTWPAPPSRGSACCCPRAPSTRTAWSTSPTWPAGTSRATSRPTPP-PIWPMPTSPSAT 733
             ++ P+PP + SA   P  P      +TSPT P       S   PP P    P   SA 
Sbjct: 285 PPQSAPSPP-KSSAAPSPSQPKA----NTSPTAPPAKQPGHSPANPPHPNGKTPEPSSAK 339

Query: 734 PTSCWTCARPAPSCSGTSMRAAWPT*PPA---------------AAWTAWWR 844
           PT     A   P     S R   PT   A                 WT  WR
Sbjct: 340 PTPPRRYANATPKPETDSNRKTKPTTKEAHMSNYQPTPEDRFSFGLWTVGWR 391

 Score = 58.2 bits (139), Expect = 3e-07
 Identities = 73/310 (23%), Positives = 104/310 (33%), Gaps = 14/310 (4%)
 Frame = +2

Query: 353  APPTSWCPVPPTPAPSAPWYPPSPGRRPRTAALALRVCSTARPSRPAAVG*RR*TRARPT 532
            APP    P   +P+P++P   P+    P T            P+ P            P 
Sbjct: 2    APPHGAKPSAQSPSPASP--SPNSAGSPNT-----------NPTTPP----------EPK 38

Query: 533  TTATTPSASSRTWPAPPSRGSACCCPRAPSTRT--AWSTSPTWPAGTSRATSRP------ 688
             ++   + S    P PP+       P AP+T T     T PT     S A S P      
Sbjct: 39   ASSCPTTGSPNALPKPPNPSPTAATPPAPATTTPPPTPTGPTCSPSPSAANSAPRESPPP 98

Query: 689  ------TPPPIWPMPTSPSATPTSCWTCARPAPSCSGTSMRAAWPT*PPAAAWTAWWRS* 850
                  +PPP  P  TS +  P + W    P+     TS   + P  PP+ +        
Sbjct: 99   PKSSAASPPPNSPPSTSSAPAPATTWPPHSPSTPDPATSSSPSAPPEPPSPS-------- 150

Query: 851  TRPSTSCCWTRSRSSSARCWPTPTSPPSTTITSRT*TAPPAATAAAAAARRRGCPSPLCC 1030
              P        + S  +   P  +SP S   T    + P    +A+ +      PSP   
Sbjct: 151  --PKNPPPTPPAPSPDSPTPPDASSPSSAPSTQPASSPPEPLRSASPSKNSTNSPSPHPP 208

Query: 1031 PPWARCCSLRLVLCMRCATTASTRTCSARWCRPAWAPTPPSWSPRSRTTTRLWTRSPARQ 1210
             P A             +++  T T +A    P   PTPP+ S  S   T      PA  
Sbjct: 209  APAA-------------SSSCPTSTANA----PPTCPTPPAASTASPEPTSPPPTWPAPS 251

Query: 1211 WTGCSRTTTT 1240
               CS  + T
Sbjct: 252  SKACSAASLT 261

>ref|XP_318717.1| ENSANGP00000004655 [Anopheles gambiae] gi|30174516|gb|EAA13969.2|
            ENSANGP00000004655 [Anopheles gambiae str. PEST]
          Length = 3150

 Score = 81.3 bits (199), Expect = 3e-14
 Identities = 105/414 (25%), Positives = 152/414 (36%), Gaps = 16/414 (3%)
 Frame = +2

Query: 47   PSTIRAFDRNPALVDNADHGQGCSRCTRRSSACHPWTTRWRTSATWWARRRRTRAEPWRS 226
            P T R     P   ++ D     +     S+   P TTR  T+ T       T +    S
Sbjct: 2745 PGTTRTTPTRPTSTESTDTTMSSASTPEPSTT--PGTTR--TTPTRPTPTDTTMSSSMSS 2800

Query: 227  ASPTAPASWAWGWETSSRRSRRRPSAASWAWRSCPAPSRSSTAPPTSWCPVPPTPAPSAP 406
            AS   P++      T+  R     S  S +  S   P  S+T   T   P  PTP  S  
Sbjct: 2801 ASTPEPSTTPGTTRTTPTRPTPTDSTMSSSMSSASTPEPSTTPGTTRTTPTRPTPTDSTM 2860

Query: 407  WYPPS-----PGRR--------PRTAALALRVCSTARPSRPAAVG*RR*TRARPTTTATT 547
                S     PG          P  + ++  + S + P      G  R T  RPT T +T
Sbjct: 2861 SSSMSSVSTTPGTTRTTPTRPTPTDSTMSSSMSSASTPEPSTTPGTTRTTPTRPTPTDST 2920

Query: 548  PSAS--SRTWPAPPSR-GSACCCPRAPSTRTAWSTSPTWPAGTSRATSRPTPPPIWPMPT 718
             S+S  S + P P +  G+    P  P+   +  +S    A T   T+  TP      PT
Sbjct: 2921 MSSSMSSASTPEPSTTPGTTRTTPTRPTPTDSTMSSSMSSASTPEPTT--TPGTTRTTPT 2978

Query: 719  SPSATPTSCWTCARPAPSCSGTSMRAAWPT*PPAAAWTAWWRS*TRPSTSCCWTRSRSSS 898
             P+ T ++  + + P PS +  + R   PT P              P+ S   T S S S
Sbjct: 2979 RPTPTDSTMSSASTPKPSSTPGTTRTT-PTRPT-------------PTDS---TMSSSMS 3021

Query: 899  ARCWPTPTSPPSTTITSRT*TAPPAATAAAAAARRRGCPSPLCCPPWARCCSLRLVLCMR 1078
            + C P P++ P TT T+ T   P   T ++A+      P P   P   R    R      
Sbjct: 3022 SACTPEPSTTPGTTRTTPTRPTPTDTTMSSAST-----PEPSTTPGTTRTTPTRPT---P 3073

Query: 1079 CATTASTRTCSARWCRPAWAPTPPSWSPRSRTTTRLWTRSPARQWTGCSRTTTT 1240
              +T S+   SA    P+  P     +P    TT       +  WT  +  +TT
Sbjct: 3074 TDSTMSSSMSSASTPEPSTTPGTTRTTPTRPATTSSSRNPSSTSWTTVTNRSTT 3127

 Score = 79.7 bits (195), Expect = 1e-13
 Identities = 110/400 (27%), Positives = 152/400 (37%), Gaps = 31/400 (7%)
 Frame = +2

Query: 134  SSACHPWTTRWRTSATWWARRRRTRAEPWRSASPTAPASWAWGWETSSRRSRRRPSAASW 313
            +S   P TT   T  T     R T  +   S++ T   S   G   ++R +  RP+    
Sbjct: 125  ASTPQPSTTPGTTRTT---PTRPTPTDTTMSSASTPEPSTTPG---TTRTTPTRPTPTDT 178

Query: 314  AWRSCPAPSRSSTAPPTSWCPVPPTP------APSAPWYPPSPGR------RPRTAALAL 457
               S   P  S+T   T   P  PTP      + S P    +PG       RP      +
Sbjct: 179  TMSSESTPEPSTTPGTTRTTPTRPTPTDTTMSSASTPEPSTTPGTTRTTPTRPTPTDSTM 238

Query: 458  RVCSTARPSRPAAVG*RR*TRARPTTTATTPSA-SSRTWPAPPSR-GSACCCPRAP---- 619
               ST  PS     G  R T  RPT+T +T +  SS + P P +  G+    P  P    
Sbjct: 239  SSASTPEPS--TTPGTTRTTPTRPTSTESTDTTMSSASTPEPSTTPGTTRTTPTRPTSTE 296

Query: 620  STRTAWSTSPTWPAGTSRATSRPTPPPIWPMPTSPSATPTSCWTCARPAPSCSGTSMRAA 799
            ST T  S++ T    T+  T+R TP      PTS  +T T+  + + P PS +  + R  
Sbjct: 297  STDTTMSSASTPEPSTTPGTTRTTPT----RPTSTESTDTTMSSASTPEPSTTPGTTRTT 352

Query: 800  WPT*PPAAAWTAWWRS*TRPSTSCCWTRS------------RSSSARCWPTPTSPPSTTI 943
             PT P +   T    S   PST+   TR+             + S+   P P++ P TT 
Sbjct: 353  -PTRPTSTDTTMSSASTPEPSTTPGTTRTTPTRPTSTESTDTTMSSASTPEPSTTPGTTR 411

Query: 944  TSRT*TAPPAATAAAAAARRRGCPSPLCCPPWARCCSLRLVLCMRCATTASTRTCSARWC 1123
            T  T T P +  +          P P   P   R    R        TT S+ +      
Sbjct: 412  T--TPTRPTSTESTDTTMSSASTPEPSTTPGTTRTTPTRPTSTESTDTTLSSASTPEPST 469

Query: 1124 RPAWAPTPPSWSPRSRTTTRLWTRSPARQWT-GCSRTTTT 1240
             P    T P+  P S  TT     +P    T G +RTT T
Sbjct: 470  TPGTTRTTPT-RPTSTDTTMSSASTPEPSTTPGTTRTTPT 508

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 101/392 (25%), Positives = 140/392 (34%), Gaps = 23/392 (5%)
 Frame = +2

Query: 134  SSACHPWTTRWRTSATWWARRRRTRAEPWRSASPTAPASWAWGWETSSRRSRRRPSAASW 313
            +S   P TT   T  T          +   S++ T   S   G   ++R +  RP+    
Sbjct: 6    ASTPEPSTTPGTTRTTPTRPTSTESTDTTMSSASTPEPSTTPG---TTRTTPTRPTPTDS 62

Query: 314  AWRSCPAPSRSSTAPPTSWCPVPPTPAPS--APWYPPSPGRRPRTAALA--------LRV 463
               S   P  S+T   T   P  PTP  +  +  Y P P   P T              +
Sbjct: 63   TMSSASTPEPSTTPGTTRTTPTRPTPTDTTMSSAYTPDPSSTPGTTRTTPTRQTPTDTTM 122

Query: 464  CSTARPSRPAAVG*RR*TRARPTTTATTPSASSRTWPAPPSRGSACCCPRAPSTRTAWST 643
             S + P      G  R T  RPT T TT S++S   P+     +     R   T T  S+
Sbjct: 123  SSASTPQPSTTPGTTRTTPTRPTPTDTTMSSASTPEPSTTPGTTRTTPTRPTPTDTTMSS 182

Query: 644  SPTWPAGTSRATSRPTPPPIWPMPTSPSATPTSCWTCARPAPSCSGTSMRAAWPT*PPAA 823
              T    T+  T+R T       PT P+ T T+  + + P PS +  + R   PT P   
Sbjct: 183  ESTPEPSTTPGTTRTT-------PTRPTPTDTTMSSASTPEPSTTPGTTRTT-PTRPTPT 234

Query: 824  AWTAWWRS*TRPSTSCCWTRS------------RSSSARCWPTPTSPPSTTITSRT*TAP 967
              T    S   PST+   TR+             + S+   P P++ P TT T  T T P
Sbjct: 235  DSTMSSASTPEPSTTPGTTRTTPTRPTSTESTDTTMSSASTPEPSTTPGTTRT--TPTRP 292

Query: 968  PAATAAAAAARRRGCPSPLCCPPWARCCSLRLVLCMRCATTASTRTCSARWCRPAWAPTP 1147
             +  +          P P   P   R    R        TT S+ +       P    T 
Sbjct: 293  TSTESTDTTMSSASTPEPSTTPGTTRTTPTRPTSTESTDTTMSSASTPEPSTTPGTTRTT 352

Query: 1148 PSWSPRSRTTTRLWTRSPARQWT-GCSRTTTT 1240
            P+  P S  TT     +P    T G +RTT T
Sbjct: 353  PT-RPTSTDTTMSSASTPEPSTTPGTTRTTPT 383

 Score = 79.0 bits (193), Expect = 2e-13
 Identities = 96/359 (26%), Positives = 136/359 (37%), Gaps = 22/359 (6%)
 Frame = +2

Query: 230  SPTAPASWAWGWETSSRRSRRRPSAASWAWRSCPAPSRSSTAPPTSWCPVPPTPAPSA-P 406
            +PT P S      T S  S   PS      R+ P    S+ +  T+      TP PS  P
Sbjct: 706  TPTRPTSTESTDTTMSSASTPEPSTTPGTTRTTPTRPTSTESTDTTMSSAS-TPEPSTTP 764

Query: 407  WYPPSPGRRPRTAALALRVCSTARPSRPAAVG*RR*TRARPTTTATTPSASSRTWPAPPS 586
                +   RP +    +   ST  PS     G  R T  RPT+T +T +  S    + PS
Sbjct: 765  GTTRTTPTRPTSTDTTMSSASTPEPS--TTPGTTRTTPTRPTSTESTDTTMSSASTSEPS 822

Query: 587  R--GSACCCPRAP----STRTAWSTSPTWPAGTSRATSRPTPPPIWPMPTSPSATPTSCW 748
               G+    P  P    ST T  S++ T    T+  T+R TP      PTS  +T T+  
Sbjct: 823  TTPGTTRTTPTRPTSTESTDTTMSSASTPEPSTTPGTTRTTPT----RPTSTESTDTTMS 878

Query: 749  TCARPAPSCSGTSMRAAWPT*PPAAAWTAWWRS*TRPSTSCCWTRS------------RS 892
            + + P PS +  + R   PT P     T    S   PST+   TR+             +
Sbjct: 879  SASTPEPSTTSGTTRTT-PTRPTPTDTTMSSASTPEPSTTPGTTRTTPTRPTSTESTDTT 937

Query: 893  SSARCWPTPTSPPSTTITSRT*TAPPAATAAAAAARRRGCPSPLCCPPWARCCSLRLVLC 1072
             S+   P P++ P TT T  T T P +  +          P P   P   R    R    
Sbjct: 938  MSSASTPEPSTTPGTTRT--TPTRPTSTESTDTTMSSASTPEPSTTPGTTRTTPTRPTST 995

Query: 1073 MRCATTASTRTCSARWCRPA---WAPTPPSWSPRSRTTTRLWTRSPARQWTGCSRTTTT 1240
                TT S+ +      +P      PT P+ +  + TT    + +      G +RTT T
Sbjct: 996  ESTDTTMSSASTPEPSTKPGTTRTTPTRPTTTESTDTTMSSASTTEPSTTPGTTRTTPT 1054

 Score = 78.2 bits (191), Expect = 3e-13
 Identities = 100/359 (27%), Positives = 138/359 (37%), Gaps = 22/359 (6%)
 Frame = +2

Query: 230  SPTAPASWAWGWETSSRRSRRRPSAASWAWRSCPAPSRSSTAPPTSWCPVPPTPAPSA-P 406
            +PT P S      T S  S   PS      R+ P    S+ +  T+      TP PS  P
Sbjct: 288  TPTRPTSTESTDTTMSSASTPEPSTTPGTTRTTPTRPTSTESTDTTMSSAS-TPEPSTTP 346

Query: 407  WYPPSPGRRPRTAALALRVCSTARPSRPAAVG*RR*TRARPTTTATTPSA-SSRTWPAPP 583
                +   RP +    +   ST  PS     G  R T  RPT+T +T +  SS + P P 
Sbjct: 347  GTTRTTPTRPTSTDTTMSSASTPEPS--TTPGTTRTTPTRPTSTESTDTTMSSASTPEPS 404

Query: 584  SR-GSACCCPRAP----STRTAWSTSPTWPAGTSRATSRPTPPPIWPMPTSPSATPTSCW 748
            +  G+    P  P    ST T  S++ T    T+  T+R TP      PTS  +T T+  
Sbjct: 405  TTPGTTRTTPTRPTSTESTDTTMSSASTPEPSTTPGTTRTTPT----RPTSTESTDTTLS 460

Query: 749  TCARPAPSCSGTSMRAAWPT*PPAAAWTAWWRS*TRPSTSCCWTRS------------RS 892
            + + P PS +  + R   PT P +   T    S   PST+   TR+             +
Sbjct: 461  SASTPEPSTTPGTTRTT-PTRPTSTDTTMSSASTPEPSTTPGTTRTTPTRPTSTESTDTT 519

Query: 893  SSARCWPTPTSPPSTTITSRT*TAPPAATAAAAAARRRGCPSPLCCPPWARCCSLRLVLC 1072
             S+   P P++ P TT T  T T P +  +          P P   P   R    R    
Sbjct: 520  MSSASTPEPSTTPGTTRT--TPTRPTSTESTDTTMSSASTPEPSTTPGTTRTTPTRPTST 577

Query: 1073 MRCATTASTRTCSARWCRPAWAPTPPS--WSPRSRTTTRLWTRSPARQWT-GCSRTTTT 1240
                TT S+ +       P    T P+   S  S  TT     +P    T G +RTT T
Sbjct: 578  ESTDTTMSSASTPEPSTTPGTTRTTPTRPTSTESTDTTMSSASTPEPSTTPGTTRTTPT 636

 Score = 77.0 bits (188), Expect = 7e-13
 Identities = 95/356 (26%), Positives = 136/356 (37%), Gaps = 19/356 (5%)
 Frame = +2

Query: 230  SPTAPASWAWGWETSSRRSRRRPSAASWAWRSCPA-PSRSSTAPPTSWCPVPPTPAPSAP 406
            +PT P S      T S  S   PS      R+ P  P+ + +   T      P P+ +  
Sbjct: 256  TPTRPTSTESTDTTMSSASTPEPSTTPGTTRTTPTRPTSTESTDTTMSSASTPEPSTTPG 315

Query: 407  WYPPSPGRRPRTAALALRVCSTARPSRPAAVG*RR*TRARPTTTATTPSASSRTWPAPPS 586
                +P R   T +    + S + P      G  R T  RPT+T TT S++S   P+  +
Sbjct: 316  TTRTTPTRPTSTESTDTTMSSASTPEPSTTPGTTRTTPTRPTSTDTTMSSASTPEPST-T 374

Query: 587  RGSACCCPRAP----STRTAWSTSPTWPAGTSRATSRPTPPPIWPMPTSPSATPTSCWTC 754
             G+    P  P    ST T  S++ T    T+  T+R TP      PTS  +T T+  + 
Sbjct: 375  PGTTRTTPTRPTSTESTDTTMSSASTPEPSTTPGTTRTTPT----RPTSTESTDTTMSSA 430

Query: 755  ARPAPSCSGTSMRA--AWPT*PPAAAWTAWWRS*TRPSTSCCWTRS---------RSSSA 901
            + P PS +  + R     PT   +   T    S   PST+   TR+          + S+
Sbjct: 431  STPEPSTTPGTTRTTPTRPTSTESTDTTLSSASTPEPSTTPGTTRTTPTRPTSTDTTMSS 490

Query: 902  RCWPTPTSPPSTTITSRT*TAPPAATAAAAAARRRGCPSPLCCPPWARCCSLRLVLCMRC 1081
               P P++ P TT T  T T P +  +          P P   P   R    R       
Sbjct: 491  ASTPEPSTTPGTTRT--TPTRPTSTESTDTTMSSASTPEPSTTPGTTRTTPTRPTSTEST 548

Query: 1082 ATTASTRTCSARWCRPAWAPTPPS--WSPRSRTTTRLWTRSPARQWT-GCSRTTTT 1240
             TT S+ +       P    T P+   S  S  TT     +P    T G +RTT T
Sbjct: 549  DTTMSSASTPEPSTTPGTTRTTPTRPTSTESTDTTMSSASTPEPSTTPGTTRTTPT 604

 Score = 75.9 bits (185), Expect = 1e-12
 Identities = 103/364 (28%), Positives = 136/364 (37%), Gaps = 27/364 (7%)
 Frame = +2

Query: 230  SPTAPASWAWGWETSSRRSRRRPSAASWAWRSCPAPSRSSTAPPTSWCPVPPTPAPSA-P 406
            +PT P S      T S  S   PS      R+ P    S+ +  T+      TP PS  P
Sbjct: 1465 TPTRPTSTESTDTTMSSASTPEPSTTPGTTRTTPTRPTSTESTDTTMSSAY-TPDPSGIP 1523

Query: 407  WYPPSPGRRPRTAALALRVCSTARPSRPAAVG*RR*TRARPTTTATTPSA-SSRTWPAPP 583
                +   RP      +   ST  PS     G  R T  RPT+T +T +  SS + P P 
Sbjct: 1524 GTTRTTPTRPTPTETTMSSASTPEPSMTP--GTTRTTPTRPTSTESTDTTMSSASTPEPS 1581

Query: 584  SR-GSACCCPRAP----STRTAWSTSPTWPAGTSRATSRPTPPPIWPMPTSPSATPTSCW 748
            +  G+    P  P    ST T  S++ T    T+  T+R TP      PTS  +T T+  
Sbjct: 1582 TTPGTTRTTPTRPTSTESTDTTMSSASTPEPSTTPGTTRTTPT----RPTSTESTDTTMS 1637

Query: 749  TCARPAPSCSGTSMRAAWPT*PPAAAWTAWWRS*TRPSTSCCWTR--------------- 883
            + + P PS +  + R   PT P     T    S   PST+   TR               
Sbjct: 1638 SASTPEPSTTPGTTRTT-PTRPTPTDTTMSSASTPEPSTTPGTTRTTPTRPTPTDSTMSS 1696

Query: 884  SRSSSARCWPTPTSPPSTT--ITSRT*TAPPAATAAAAAARRRGCPSPLCCPPWARCCSL 1057
            S SS +   P+ T  PSTT   T  T T P +  +          P P   P   R    
Sbjct: 1697 SMSSESTPEPSTTPEPSTTPGTTRTTPTRPTSTESTDTTMSSASTPEPSTTPGTTRTTPT 1756

Query: 1058 RLVLCMRCATTASTRTCSARWCRPAWAPTPPS--WSPRSRTTTRLWTRSPARQWT-GCSR 1228
            R        TT S+ +       P    T P+   S  S  TT     +P    T G +R
Sbjct: 1757 RPTSTESTDTTMSSASTPEPSTTPGTTRTTPTRPTSTESTDTTMSSASTPEPSTTPGTTR 1816

Query: 1229 TTTT 1240
            TT T
Sbjct: 1817 TTPT 1820

 Score = 75.1 bits (183), Expect = 2e-12
 Identities = 109/433 (25%), Positives = 159/433 (36%), Gaps = 35/433 (8%)
 Frame = +2

Query: 47   PSTIRAFDRNPALVDNADHGQGCSRCTRRSSACHPWTTRWR------TSATWWARRRRTR 208
            P T R     P   ++ D     +     S+   P TTR        T +T       + 
Sbjct: 1363 PGTTRTTPTRPTSTESTDTTMSSASTPEPSTT--PGTTRTTPTRPTSTESTDTTMSSAST 1420

Query: 209  AEPWRS-----ASPTAPASWAWGWETSSRRSRRRPSAASWAWRSCPA-PSRSSTAPPTSW 370
             EP  +      +PT P S      T S  S   PS      R+ P  P+ + +   T  
Sbjct: 1421 PEPTTTPGTTRTTPTRPTSTESTDTTMSSASTPEPSTTPGTTRTTPTRPTSTESTDTTMS 1480

Query: 371  CPVPPTPAPSAPWYPPSPGRRPRTAALALRVCSTARPSRPAAVG*RR*TRARPTTTATTP 550
                P P+ +      +P R   T +    + S   P      G  R T  RPT T TT 
Sbjct: 1481 SASTPEPSTTPGTTRTTPTRPTSTESTDTTMSSAYTPDPSGIPGTTRTTPTRPTPTETTM 1540

Query: 551  SASSRTWPAPPSRGSACCCPRAP----STRTAWSTSPTWPAGTSRATSRPTPPPIWPMPT 718
            S++S   P+  + G+    P  P    ST T  S++ T    T+  T+R TP      PT
Sbjct: 1541 SSASTPEPSM-TPGTTRTTPTRPTSTESTDTTMSSASTPEPSTTPGTTRTTPT----RPT 1595

Query: 719  SPSATPTSCWTCARPAPSCSGTSMRA--AWPT*PPAAAWTAWWRS*TRPSTSCCWTRS-- 886
            S  +T T+  + + P PS +  + R     PT   +   T    S   PST+   TR+  
Sbjct: 1596 STESTDTTMSSASTPEPSTTPGTTRTTPTRPTSTESTDTTMSSASTPEPSTTPGTTRTTP 1655

Query: 887  -------RSSSARCWPTPTSPPSTTITSRT*TAPPAATAAAAAARR-----RGCPSPLCC 1030
                    + S+   P P++ P TT T+ T   P  +T +++ +          P P   
Sbjct: 1656 TRPTPTDTTMSSASTPEPSTTPGTTRTTPTRPTPTDSTMSSSMSSESTPEPSTTPEPSTT 1715

Query: 1031 PPWARCCSLRLVLCMRCATTASTRTCSARWCRPAWAPTPPS--WSPRSRTTTRLWTRSPA 1204
            P   R    R        TT S+ +       P    T P+   S  S  TT     +P 
Sbjct: 1716 PGTTRTTPTRPTSTESTDTTMSSASTPEPSTTPGTTRTTPTRPTSTESTDTTMSSASTPE 1775

Query: 1205 RQWT-GCSRTTTT 1240
               T G +RTT T
Sbjct: 1776 PSTTPGTTRTTPT 1788

 Score = 73.9 bits (180), Expect = 6e-12
 Identities = 108/415 (26%), Positives = 149/415 (35%), Gaps = 17/415 (4%)
 Frame = +2

Query: 47   PSTIRAFDRNPALVDNADHGQGCSRCTRRSSAC--HPWTTRWRTSATWWARRRRTRAEPW 220
            P T R     P   ++ D        T  SSA    P TT   T  T       TR    
Sbjct: 596  PGTTRTTPTRPTSTESTD--------TTMSSASTPEPSTTPGTTRTT------PTRPTST 641

Query: 221  RSASPTAPASWAWGWETSSRRSRRRPSAASWAWRSCPAPSRSSTAPPTSWCPVPPTPAPS 400
               +PT P S      T S  S   PS      R+   P+R +    T      P P+ +
Sbjct: 642  GKTTPTRPTSTESTDTTMSSASTPEPSTTPGTTRT--TPTRPTPTDSTMSSASTPEPSTT 699

Query: 401  APWYPPSPGRRPRTAALALRVCSTARPSRPAAVG*RR*TRARPTTTATTPSA-SSRTWPA 577
                  +P R   T +    + S + P      G  R T  RPT+T +T +  SS + P 
Sbjct: 700  PGTTRTTPTRPTSTESTDTTMSSASTPEPSTTPGTTRTTPTRPTSTESTDTTMSSASTPE 759

Query: 578  PPSR-GSACCCPRAP-STRTAWSTSPTWPAGTSRATSRPTPPPIWPMPTSPSATPTSCWT 751
            P +  G+    P  P ST T  S++ T    T+  T+R TP      PTS  +T T+  +
Sbjct: 760  PSTTPGTTRTTPTRPTSTDTTMSSASTPEPSTTPGTTRTTP----TRPTSTESTDTTMSS 815

Query: 752  CARPAPSCSGTSMRA--AWPT*PPAAAWTAWWRS*TRPSTSCCWTR-------SRSSSAR 904
             +   PS +  + R     PT   +   T    S   PST+   TR       S  S+  
Sbjct: 816  ASTSEPSTTPGTTRTTPTRPTSTESTDTTMSSASTPEPSTTPGTTRTTPTRPTSTESTDT 875

Query: 905  CWPTPTSPPSTTITSRT*TAPPAATAAAAAARRRGCPSPLCCPPWARCCSLRLVLCMRCA 1084
               + ++P  +T +  T T P   T           P P   P   R    R        
Sbjct: 876  TMSSASTPEPSTTSGTTRTTPTRPTPTDTTMSSASTPEPSTTPGTTRTTPTRPTSTESTD 935

Query: 1085 TTASTRTCSARWCRPAWAPTPPS--WSPRSRTTTRLWTRSPARQWT-GCSRTTTT 1240
            TT S+ +       P    T P+   S  S  TT     +P    T G +RTT T
Sbjct: 936  TTMSSASTPEPSTTPGTTRTTPTRPTSTESTDTTMSSASTPEPSTTPGTTRTTPT 990

 Score = 73.9 bits (180), Expect = 6e-12
 Identities = 98/350 (28%), Positives = 138/350 (39%), Gaps = 13/350 (3%)
 Frame = +2

Query: 230  SPTAPASWAWGWETSSRRSRRRPSAASWAWRSCPAPSRSSTAPPTSWCPVPPTPAPSA-P 406
            +PT P S      T S  S   PS      R+ P    S+ +  T+      TP PS  P
Sbjct: 2475 TPTRPTSTESTDTTMSSASTPEPSTTPGTTRTTPTRPTSTESTDTTMTTAS-TPEPSTTP 2533

Query: 407  WYPPSPGRRPRTAALALRVCSTARPSRPAAVG*RR*TRARPTTTATTPSASSRTWPAPPS 586
                +   RP      +   ST  PS     G  R T  RPT T TT S++S   P+   
Sbjct: 2534 DTTRTTPTRPTPTDTTMSSASTPEPS--TTPGTTRTTPTRPTPTDTTMSSASTPEPSTTP 2591

Query: 587  RGSACCCPRAPSTRTAWSTS--------PTWPAGTSRAT-SRPTPPP--IWPMPTSPSAT 733
              +     R  ST T  S+S        P+   GT+R T +RPTP    +    +S SAT
Sbjct: 2592 GTTRTTPTRPTSTDTTMSSSMSSASTPEPSTTPGTTRTTPTRPTPTDSTMSSSMSSASAT 2651

Query: 734  P-TSCWTCARPAPSCSGTSMRAAWPT*PPAAAWTAWWRS*TRPSTSCCWTRSRSSSARCW 910
            P T+  T  RP  + S  +  ++  T  P+        + TRP TS   T S S S+   
Sbjct: 2652 PGTTRTTPTRPTSTESTDTTMSSASTPEPSTTPGTTRTTPTRP-TSTDSTMSSSMSSAST 2710

Query: 911  PTPTSPPSTTITSRT*TAPPAATAAAAAARRRGCPSPLCCPPWARCCSLRLVLCMRCATT 1090
            P P++ P TT T+ T   P  +T +++ +     P      P     +      M  A+T
Sbjct: 2711 PEPSTTPGTTRTTPTRPTPTDSTMSSSMSSASTTPGTTRTTPTRPTSTESTDTTMSSAST 2770

Query: 1091 ASTRTCSARWCRPAWAPTPPSWSPRSRTTTRLWTRSPARQWTGCSRTTTT 1240
                T           PTP   +  S + +   T  P+    G +RTT T
Sbjct: 2771 PEPSTTPGTTRTTPTRPTPTD-TTMSSSMSSASTPEPSTT-PGTTRTTPT 2818

 Score = 73.9 bits (180), Expect = 6e-12
 Identities = 110/436 (25%), Positives = 161/436 (36%), Gaps = 38/436 (8%)
 Frame = +2

Query: 47   PSTIRAFDRNPALVDNADHGQGCSRCTRRSSACHPW-TTRWRTSATWWARRRRTRAEPWR 223
            P T R     P   ++ D        T  SSA  P  +T   T+ T   R   T +    
Sbjct: 825  PGTTRTTPTRPTSTESTD--------TTMSSASTPEPSTTPGTTRTTPTRPTSTESTDTT 876

Query: 224  SASPTAPASWAWGWETSSRRSRRRPSAASWAWRSCPAPS------RSSTAPPTSW----- 370
             +S + P        T +  +R  P+  + +  S P PS      R++   PTS      
Sbjct: 877  MSSASTPEPSTTSGTTRTTPTRPTPTDTTMSSASTPEPSTTPGTTRTTPTRPTSTESTDT 936

Query: 371  ---CPVPPTPAPSAPWYPPSPGRRPRTAALALRVCSTARPSRPAAVG*RR*TRARPTTTA 541
                   P P+ +      +P R   T +    + S + P      G  R T  RPT+T 
Sbjct: 937  TMSSASTPEPSTTPGTTRTTPTRPTSTESTDTTMSSASTPEPSTTPGTTRTTPTRPTSTE 996

Query: 542  TTPSA-SSRTWPAPPSR-GSACCCPRAP----STRTAWSTSPTWPAGTSRATSRPTPPPI 703
            +T +  SS + P P ++ G+    P  P    ST T  S++ T    T+  T+R TP   
Sbjct: 997  STDTTMSSASTPEPSTKPGTTRTTPTRPTTTESTDTTMSSASTTEPSTTPGTTRTTPT-- 1054

Query: 704  WPMPTSPSATPTSCWTCARPAPSCSGTSMRA--AWPT*PPAAAWTAWWRS*TRPSTSCCW 877
               PTS  +T T+  + + P PS +  + R     PT   +   T    S   PST+   
Sbjct: 1055 --RPTSTESTDTTMSSASTPEPSTTPGTTRTTPTRPTSTESTDTTMSSASTPEPSTTPGT 1112

Query: 878  TRS------------RSSSARCWPTPTSPPSTTITSRT*TAPPAATAAAAAARRRGCPSP 1021
            TR+             + S+   P P++ P TT T  T T P +  +          P P
Sbjct: 1113 TRTTPTRPTSTESTDTTMSSASTPEPSTTPGTTRT--TPTRPTSTESTDTTMSSASTPEP 1170

Query: 1022 LCCPPWARCCSLRLVLCMRCATTASTRTCSARWCRPAWAPTPPS--WSPRSRTTTRLWTR 1195
               P   R    R        TT S+ +       P    T P+   S  S  TT     
Sbjct: 1171 STTPGTTRTTPTRPTSTESTDTTMSSASTPEPSTTPGTTRTTPTRPTSTESTDTTMSSAS 1230

Query: 1196 SPARQWT-GCSRTTTT 1240
            +P    T G +RTT T
Sbjct: 1231 TPEPSTTPGTTRTTPT 1246

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 114/444 (25%), Positives = 156/444 (34%), Gaps = 46/444 (10%)
 Frame = +2

Query: 47   PSTIRAFDRNPALVDNADHGQGCSRCTRRSSAC--HPWTTRWRTSATWWARRRRTRAEPW 220
            P T R     P   ++ D        T  SSA    P TT   T  T          +  
Sbjct: 1584 PGTTRTTPTRPTSTESTD--------TTMSSASTPEPSTTPGTTRTTPTRPTSTESTDTT 1635

Query: 221  RSASPTAPASWAWGWETSSRRSRRRPSAASWAWRSCPAPSRSSTAPPTSWCPVPPTPAPS 400
             S++ T   S   G   ++R +  RP+       S   P  S+T   T   P  PTP  S
Sbjct: 1636 MSSASTPEPSTTPG---TTRTTPTRPTPTDTTMSSASTPEPSTTPGTTRTTPTRPTPTDS 1692

Query: 401  A------------PWYPPSPGRRPRTAALA-----------LRVCSTARPSRPAAVG*RR 511
                         P   P P   P T                 + S + P      G  R
Sbjct: 1693 TMSSSMSSESTPEPSTTPEPSTTPGTTRTTPTRPTSTESTDTTMSSASTPEPSTTPGTTR 1752

Query: 512  *TRARPTTTATTPSA-SSRTWPAPPSR-GSACCCPRAP----STRTAWSTSPTWPAGTSR 673
             T  RPT+T +T +  SS + P P +  G+    P  P    ST T  S++ T    T+ 
Sbjct: 1753 TTPTRPTSTESTDTTMSSASTPEPSTTPGTTRTTPTRPTSTESTDTTMSSASTPEPSTTP 1812

Query: 674  ATSRPTPPPIWPMPTSPSATPTSCWTCARPAPSCSGTSMRA--AWPT*PPAAAWTAWWRS 847
             T+R TP      PTS  +T T+  + + P PS +  + R     PT   +   T    S
Sbjct: 1813 GTTRTTPT----RPTSTESTDTTMSSASTPEPSTTPGTTRTTPTRPTSTESTDTTMSSAS 1868

Query: 848  *TRPSTSCCWTRS------------RSSSARCWPTPTSPPSTTITSRT*TAPPAATAAAA 991
               PST+   TR+             + S+   P P++ P TT T  T T P +  +   
Sbjct: 1869 TPEPSTTPGTTRTTPTRPTSTESTDTTMSSASTPEPSTTPGTTRT--TPTRPTSTESTDT 1926

Query: 992  AARRRGCPSPLCCPPWARCCSLRLVLCMRCATTASTRTCSARWCRPAWAPTPPSWSPRSR 1171
                   P P   P   R    R        ++AST   S         PT P+ S  S 
Sbjct: 1927 TMSSASTPDPSTTPGTTRTTPTRPTPTETTMSSASTPEPSMTPGTTRTTPTRPT-STEST 1985

Query: 1172 TTTRLWTRSPARQWT-GCSRTTTT 1240
             TT     +P    T G +RTT T
Sbjct: 1986 DTTMSSASTPEPSTTPGTTRTTPT 2009

 Score = 72.8 bits (177), Expect = 1e-11
 Identities = 111/421 (26%), Positives = 157/421 (36%), Gaps = 19/421 (4%)
 Frame = +2

Query: 47   PSTIRAFDRNPALVDNADHGQGCSRCTRRSSACHPWTTRWR------TSATWWARRRRTR 208
            P T R     P   ++ D     +     S+   P TTR        T +T       + 
Sbjct: 1812 PGTTRTTPTRPTSTESTDTTMSSASTPEPSTT--PGTTRTTPTRPTSTESTDTTMSSAST 1869

Query: 209  AEPWRS-----ASPTAPASWAWGWETSSRRSRRRPSAASWAWRSCPAPSRSSTAPPTSWC 373
             EP  +      +PT P S      T S  S   PS      R+ P    S+ +  T+  
Sbjct: 1870 PEPSTTPGTTRTTPTRPTSTESTDTTMSSASTPEPSTTPGTTRTTPTRPTSTESTDTTMS 1929

Query: 374  PVPPTPAPSA-PWYPPSPGRRPRTAALALRVCSTARPSRPAAVG*RR*TRARPTTTATTP 550
                TP PS  P    +   RP      +   ST  PS     G  R T  RPT+T +T 
Sbjct: 1930 SAS-TPDPSTTPGTTRTTPTRPTPTETTMSSASTPEPSMTP--GTTRTTPTRPTSTESTD 1986

Query: 551  SA-SSRTWPAPPSR-GSACCCPRAPS----TRTAWSTSPTWPAGTSRATSRPTPPPIWPM 712
            +  SS + P P +  G+    P  P+    T T  S++ T    T+  T+R TP      
Sbjct: 1987 TTMSSASTPEPSTTPGTTRTTPTRPTSTERTDTTMSSAYTPEPSTTPGTTRTTPT----R 2042

Query: 713  PTSPSATPTSCWTCARPAPSCSGTSMRAAWPT*PPAAAWTAWWRS*TRPSTSCCWTRSRS 892
            PTS  +T T+  + + P PS +  + R   PT P +   T    S   PST+   TR+  
Sbjct: 2043 PTSTESTDTTMSSASTPEPSTTPGTTRTT-PTRPTSTDSTMSSASTPEPSTTPGTTRT-- 2099

Query: 893  SSARCWPTPTSPPSTTITSRT*TAPPAATAAAAAARRRGCPSPLCCPPWARCCSLRLVLC 1072
                   TPT P ST  T  T ++      +      R  P+           S+     
Sbjct: 2100 -------TPTRPTSTESTDTTMSSASTPEPSTTPGTTRTTPTRPTSTDSTMSSSMSSAST 2152

Query: 1073 MRCATT-ASTRTCSARWCRPAWAPTPPSWSPRSRTTTRLWTRSPARQWTGCSRTTTTACA 1249
               +TT  +TRT      RP    +  S S  S +TT   TR+   + T    T TT  +
Sbjct: 2153 PEPSTTPGTTRTTPT---RPTPTDSTMSSSMSSASTTPGTTRTTPTRPTSTESTDTTMSS 2209

Query: 1250 A 1252
            A
Sbjct: 2210 A 2210

 Score = 72.0 bits (175), Expect = 2e-11
 Identities = 92/343 (26%), Positives = 134/343 (38%), Gaps = 6/343 (1%)
 Frame = +2

Query: 230  SPTAPASWAWGWETSSRRSRRRPSAASWAWRSCPA-PSRSSTAPPTSWCPVPPTPAPSAP 406
            +PT P S      T S  S   PS      R+ P  P+ + +   T      P P+ +  
Sbjct: 538  TPTRPTSTESTDTTMSSASTPEPSTTPGTTRTTPTRPTSTESTDTTMSSASTPEPSTTPG 597

Query: 407  WYPPSPGRRPRTAALALRVCSTARPSRPAAVG*RR*TRARPTTTA-TTPSASSRTWPAPP 583
                +P R   T +    + S + P      G  R T  RPT+T  TTP+  + T     
Sbjct: 598  TTRTTPTRPTSTESTDTTMSSASTPEPSTTPGTTRTTPTRPTSTGKTTPTRPTSTESTDT 657

Query: 584  SRGSACCCPRAPSTRTAWSTSPTWPAGT-SRATSRPTPPPIWPMPTSPSATPTSCWTCAR 760
            +  SA   P   +T     T+PT P  T S  +S  TP P     T+P  T T   T  R
Sbjct: 658  TMSSA-STPEPSTTPGTTRTTPTRPTPTDSTMSSASTPEP----STTPGTTRT---TPTR 709

Query: 761  PAPSCSGTSMRAAWPT*PPAAAWTAWWRS*TRPSTSCCWTRSRSSSARCWPTPTSPPSTT 940
            P  + S  +  ++  T  P+        + TRP+++     + SS++   P P++ P TT
Sbjct: 710  PTSTESTDTTMSSASTPEPSTTPGTTRTTPTRPTSTESTDTTMSSAST--PEPSTTPGTT 767

Query: 941  ITSRT*TAPPAATAAAAAARRRGCPSPLCCPPWARCCSLRLVLCMRCATTASTRTCSARW 1120
             T+ T       T ++A+      P P   P   R    R        TT S+ + S   
Sbjct: 768  RTTPTRPTSTDTTMSSAST-----PEPSTTPGTTRTTPTRPTSTESTDTTMSSASTSEPS 822

Query: 1121 CRPAWAPTPPS--WSPRSRTTTRLWTRSPARQWT-GCSRTTTT 1240
              P    T P+   S  S  TT     +P    T G +RTT T
Sbjct: 823  TTPGTTRTTPTRPTSTESTDTTMSSASTPEPSTTPGTTRTTPT 865

 Score = 70.9 bits (172), Expect = 5e-11
 Identities = 111/419 (26%), Positives = 151/419 (35%), Gaps = 21/419 (5%)
 Frame = +2

Query: 47   PSTIRAFDRNPALVDNADHGQGCSRCTRRSSACHPWTTRWR------TSATWWARRRRTR 208
            P T R     P   ++ D     +     S+   P TTR        T +T       + 
Sbjct: 1110 PGTTRTTPTRPTSTESTDTTMSSASTPEPSTT--PGTTRTTPTRPTSTESTDTTMSSAST 1167

Query: 209  AEPWRS-----ASPTAPASWAWGWETSSRRSRRRPSAASWAWRSCPAPSRSSTAPPTSWC 373
             EP  +      +PT P S      T S  S   PS      R+ P    S+ +  T+  
Sbjct: 1168 PEPSTTPGTTRTTPTRPTSTESTDTTMSSASTPEPSTTPGTTRTTPTRPTSTESTDTTMS 1227

Query: 374  PVPPTPAPSA-PWYPPSPGRRPRTAALALRVCSTARPSRPAAVG*RR*TRARPTTTATTP 550
                TP PS  P    +   RP +    +   ST  PS     G  R T  RPT+T +T 
Sbjct: 1228 SAS-TPEPSTTPGTTRTTPTRPTSTDTTMSSASTPEPS--TTPGTTRTTPTRPTSTESTD 1284

Query: 551  SA-SSRTWPAPPSR-GSACCCPRAP----STRTAWSTSPTWPAGTSRATSRPTPPPIWPM 712
            +  SS + P P +  G     P  P    ST T  S++ T    T+  T+R TP      
Sbjct: 1285 TTMSSASTPEPSTTPGITRTSPTRPTSTESTDTTMSSASTPEPTTTPDTTRTTPT----R 1340

Query: 713  PTSPSATPTSCWTCARPAPSCSGTSMRAAWPT*PPAAAWTAWWRS*TRPSTSCCWTRSRS 892
            PTS  +T T+  + + P PS +  + R   PT P               ST    T   S
Sbjct: 1341 PTSTESTDTTMSSASTPEPSTTPGTTRTT-PTRP--------------TSTESTDTTMSS 1385

Query: 893  SSARCWPTPTSPPSTTITSRT*TAPPAATAAAAAARRRGCPSPLCCPPWARCCSLRLVLC 1072
            +S    P P++ P TT T  T T P +  +          P P   P   R    R    
Sbjct: 1386 AST---PEPSTTPGTTRT--TPTRPTSTESTDTTMSSASTPEPTTTPGTTRTTPTRPTST 1440

Query: 1073 MRCATTASTRTCSARWCRPAWAPTPPS--WSPRSRTTTRLWTRSPARQWT-GCSRTTTT 1240
                TT S+ +       P    T P+   S  S  TT     +P    T G +RTT T
Sbjct: 1441 ESTDTTMSSASTPEPSTTPGTTRTTPTRPTSTESTDTTMSSASTPEPSTTPGTTRTTPT 1499

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 94/363 (25%), Positives = 135/363 (36%), Gaps = 24/363 (6%)
 Frame = +2

Query: 224  SASPTAPASWAWGWETSSRRSRRRPSAASWAWRSCPAPSRSSTAPPTSWCPVPPTPAPSA 403
            SAS   P++      T+  R     +  S +  S   P  S+T   T   P  PTP  S 
Sbjct: 2581 SASTPEPSTTPGTTRTTPTRPTSTDTTMSSSMSSASTPEPSTTPGTTRTTPTRPTPTDST 2640

Query: 404  PWYPPS------------PGRRPRTAALALRVCSTARPSRPAAVG*RR*TRARPTTTATT 547
                 S            P R   T +    + S + P      G  R T  RPT+T +T
Sbjct: 2641 MSSSMSSASATPGTTRTTPTRPTSTESTDTTMSSASTPEPSTTPGTTRTTPTRPTSTDST 2700

Query: 548  PSAS--SRTWPAPPSR-GSACCCPRAPSTRTAWSTSPTWPAGTSRATSRPTPPPIWPMPT 718
             S+S  S + P P +  G+    P  P+   +  +S    A T+  T+R TP      PT
Sbjct: 2701 MSSSMSSASTPEPSTTPGTTRTTPTRPTPTDSTMSSSMSSASTTPGTTRTTPT----RPT 2756

Query: 719  SPSATPTSCWTCARPAPSCSGTSMRAAWPT*PPAAAWTAWWRS*TRPSTSCCWTRSRSSS 898
            S  +T T+  + + P PS +  + R   PT P                T    T S S S
Sbjct: 2757 STESTDTTMSSASTPEPSTTPGTTRTT-PTRP----------------TPTDTTMSSSMS 2799

Query: 899  ARCWPTPTSPPSTTITSRT*TAPPAATAAAAAARRRGCPSPLCCPPWARCCSLRLV---- 1066
            +   P P++ P TT T+ T   P  +T +++ +     P P   P   R    R      
Sbjct: 2800 SASTPEPSTTPGTTRTTPTRPTPTDSTMSSSMS-SASTPEPSTTPGTTRTTPTRPTPTDS 2858

Query: 1067 -----LCMRCATTASTRTCSARWCRPAWAPTPPSWSPRSRTTTRLWTRSPARQWTGCSRT 1231
                 +     T  +TRT   R       PTP   S  S + +   T  P+    G +RT
Sbjct: 2859 TMSSSMSSVSTTPGTTRTTPTR-------PTPTD-STMSSSMSSASTPEPSTT-PGTTRT 2909

Query: 1232 TTT 1240
            T T
Sbjct: 2910 TPT 2912

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 87/319 (27%), Positives = 118/319 (36%), Gaps = 19/319 (5%)
 Frame = +2

Query: 47   PSTIRAFDRNPALVDNADHGQGCSRCTRRSSACHPWTTRWRTSATWWARRRRTRAEPWRS 226
            P T R     P   D+       S  T       P TTR  T+ T       T +    S
Sbjct: 2843 PGTTRTTPTRPTPTDSTMSSSMSSVSTT------PGTTR--TTPTRPTPTDSTMSSSMSS 2894

Query: 227  ASPTAPASWAWGWETSSRRSRRRPSAASWAWRSCPAPSRSSTAPPTSWCPVPPTP----- 391
            AS   P++      T+  R     S  S +  S   P  S+T   T   P  PTP     
Sbjct: 2895 ASTPEPSTTPGTTRTTPTRPTPTDSTMSSSMSSASTPEPSTTPGTTRTTPTRPTPTDSTM 2954

Query: 392  -----APSAPWYPPSPGR------RPRTAALALRVCSTARPSRPAAVG*RR*TRARPTTT 538
                 + S P    +PG       RP      +   ST +PS            + P TT
Sbjct: 2955 SSSMSSASTPEPTTTPGTTRTTPTRPTPTDSTMSSASTPKPS------------STPGTT 3002

Query: 539  ATTPSASSRTWPAPPSRGSACCCPRAPSTRTAWSTSPTWPAGTSRATSRPTPPPIWPMPT 718
             TTP+  + T     S  S+ C P   +T     T+PT P  T    S  + P       
Sbjct: 3003 RTTPTRPTPTDSTMSSSMSSACTPEPSTTPGTTRTTPTRPTPTDTTMSSASTP------- 3055

Query: 719  SPSATP-TSCWTCARPAP--SCSGTSMRAAWPT*PPAAAWTAWWRS*TRPSTSCCWTRSR 889
             PS TP T+  T  RP P  S   +SM +A  T  P+        + TRP+T+   + SR
Sbjct: 3056 EPSTTPGTTRTTPTRPTPTDSTMSSSMSSA-STPEPSTTPGTTRTTPTRPATT---SSSR 3111

Query: 890  SSSARCWPTPTSPPSTTIT 946
            + S+  W T T+  +T  T
Sbjct: 3112 NPSSTSWTTVTNRSTTRTT 3130

 Score = 67.0 bits (162), Expect = 7e-10
 Identities = 92/332 (27%), Positives = 125/332 (36%), Gaps = 26/332 (7%)
 Frame = +2

Query: 323  SCPAPSRSSTAPPTSWCPVPPTPAPSAPWYPPSPGRRPRTAALALRVCSTARPSRPAAVG 502
            S   P  S+T   T   P  PTP  S                    + S + P      G
Sbjct: 2398 SASTPEPSTTPGTTRTTPTRPTPTDST-------------------MSSASTPEPSTTPG 2438

Query: 503  *RR*TRARPTTTATTPSA-SSRTWPAPPSR-GSACCCPRAP----STRTAWSTSPTWPAG 664
              R T  RPT+T +T +  SS + P P +  G+    P  P    ST T  S++ T    
Sbjct: 2439 TTRTTPTRPTSTESTDTTMSSASTPEPSTTPGTTRTTPTRPTSTESTDTTMSSASTPEPS 2498

Query: 665  TSRATSRPTPPPIWPMPTSPSATPTSCWTCARPAPSCSGTSMRAAWPT*PPAAAWTAWWR 844
            T+  T+R TP      PTS  +T T+  T + P PS +  + R   PT P     T    
Sbjct: 2499 TTPGTTRTTPT----RPTSTESTDTTMTTASTPEPSTTPDTTRTT-PTRPTPTDTTMSSA 2553

Query: 845  S*TRPSTSCCWTRS---------RSSSARCWPTPTSPPSTTITSRT*TAPPAA-TAAAAA 994
            S   PST+   TR+          + S+   P P++ P TT T  T T P +  T  +++
Sbjct: 2554 STPEPSTTPGTTRTTPTRPTPTDTTMSSASTPEPSTTPGTTRT--TPTRPTSTDTTMSSS 2611

Query: 995  ARRRGCPSPLCCPPWARCCSLRLV---------LCMRCATTASTRTCSARWCRPAWAPTP 1147
                  P P   P   R    R           +    AT  +TRT           PT 
Sbjct: 2612 MSSASTPEPSTTPGTTRTTPTRPTPTDSTMSSSMSSASATPGTTRT----------TPTR 2661

Query: 1148 PSWSPRSRTTTRLWTRSPARQWT-GCSRTTTT 1240
            P+ S  S  TT     +P    T G +RTT T
Sbjct: 2662 PT-STESTDTTMSSASTPEPSTTPGTTRTTPT 2692

 Score = 65.1 bits (157), Expect = 3e-09
 Identities = 73/275 (26%), Positives = 111/275 (39%), Gaps = 21/275 (7%)
 Frame = +2

Query: 230  SPTAPASWAWGWETSSRRSRRRPSAASWAWRSCPAPSRSSTAPPTSWCPVPPTPAPSAPW 409
            +PT P S      T S  S   PS      R+   P+R ++   T      P P+ +   
Sbjct: 2039 TPTRPTSTESTDTTMSSASTPEPSTTPGTTRT--TPTRPTSTDSTMSSASTPEPSTTPGT 2096

Query: 410  YPPSPGRRPRTAALALRVCSTARPSRPAAVG*RR*TRARPTTTATTPSAS--SRTWPAPP 583
               +P R   T +    + S + P      G  R T  RPT+T +T S+S  S + P P 
Sbjct: 2097 TRTTPTRPTSTESTDTTMSSASTPEPSTTPGTTRTTPTRPTSTDSTMSSSMSSASTPEPS 2156

Query: 584  SR-GSACCCPRAPSTRTAWSTSPTWPAGTSRATSRPTPPPIWPMPTSPSATPTSCWTCAR 760
            +  G+    P  P+   +  +S    A T+  T+R TP      PTS  +T T+  + + 
Sbjct: 2157 TTPGTTRTTPTRPTPTDSTMSSSMSSASTTPGTTRTTPT----RPTSTESTDTTMSSAST 2212

Query: 761  PAPSCSGTSMRAAWPT*P------------------PAAAWTAWWRS*TRPSTSCCWTRS 886
            P PS +  + R   PT P                  P+        + TRP T    T S
Sbjct: 2213 PEPSTTPGTTRTT-PTRPTPTDSTMSSSMSSASTPEPSTTPGTTRTTPTRP-TPTDTTMS 2270

Query: 887  RSSSARCWPTPTSPPSTTITSRT*TAPPAATAAAA 991
             S S+   P P++ P TT T+ T   P  +T +++
Sbjct: 2271 SSMSSASTPEPSTTPGTTRTTPTRPTPTDSTMSSS 2305

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 100/379 (26%), Positives = 142/379 (37%), Gaps = 42/379 (11%)
 Frame = +2

Query: 230  SPTAPASWAWGWETSSRRSRRRPSAASWAWRSCPAPSRSSTAPPTSWCPVPPTPAPSA-P 406
            +PT P S      T S  S   PS      R+ P    S+ +  T+      TP PS  P
Sbjct: 413  TPTRPTSTESTDTTMSSASTPEPSTTPGTTRTTPTRPTSTESTDTTLSSAS-TPEPSTTP 471

Query: 407  WYPPSPGRRPRTAALALRVCSTARPSRPAAVG*RR*TRARPT------------------ 532
                +   RP +    +   ST  PS     G  R T  RPT                  
Sbjct: 472  GTTRTTPTRPTSTDTTMSSASTPEPS--TTPGTTRTTPTRPTSTESTDTTMSSASTPEPS 529

Query: 533  TTATT---------------PSASSRTWPAPPSR-GSACCCPRAP----STRTAWSTSPT 652
            TT  T                + SS + P P +  G+    P  P    ST T  S++ T
Sbjct: 530  TTPGTTRTTPTRPTSTESTDTTMSSASTPEPSTTPGTTRTTPTRPTSTESTDTTMSSAST 589

Query: 653  WPAGTSRATSRPTPPPIWPMPTSPSATPTSCWTCARPAPSCSGTSMRAAWPT*PPAAAWT 832
                T+  T+R TP      PTS  +T T+  + + P PS +  + R   PT P +   T
Sbjct: 590  PEPSTTPGTTRTTP----TRPTSTESTDTTMSSASTPEPSTTPGTTRTT-PTRPTSTGKT 644

Query: 833  AWWRS*TRPSTSCCWTRSRSSSARCWPTPTSPPSTTITSRT*TAPPAATAAAAAARRRGC 1012
                + TRP+++     + SS++   P P++ P TT T+ T   P  +T ++A+      
Sbjct: 645  ----TPTRPTSTESTDTTMSSAST--PEPSTTPGTTRTTPTRPTPTDSTMSSAST----- 693

Query: 1013 PSPLCCPPWARCCSLRLVLCMRCATTASTRTCSARWCRPAWAPTPPS--WSPRSRTTTRL 1186
            P P   P   R    R        TT S+ +       P    T P+   S  S  TT  
Sbjct: 694  PEPSTTPGTTRTTPTRPTSTESTDTTMSSASTPEPSTTPGTTRTTPTRPTSTESTDTTMS 753

Query: 1187 WTRSPARQWT-GCSRTTTT 1240
               +P    T G +RTT T
Sbjct: 754  SASTPEPSTTPGTTRTTPT 772

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 106/444 (23%), Positives = 152/444 (33%), Gaps = 46/444 (10%)
 Frame = +2

Query: 47   PSTIRAFDRNPALVDNADHGQGCSRCTRRSSACHPWTTRW---RTSATWWARRRRTRAEP 217
            P T R     P   ++ D     +     S+   P TTR    R ++T       +  EP
Sbjct: 1206 PGTTRTTPTRPTSTESTDTTMSSASTPEPSTT--PGTTRTTPTRPTSTDTTMSSASTPEP 1263

Query: 218  WRS-----ASPTAPASWAWGWETSSRRSRRRPSAASWAWRSCPA-PSRSSTAPPTSWCPV 379
              +      +PT P S      T S  S   PS      R+ P  P+ + +   T     
Sbjct: 1264 STTPGTTRTTPTRPTSTESTDTTMSSASTPEPSTTPGITRTSPTRPTSTESTDTTMSSAS 1323

Query: 380  PPTPAPSAPWYPPSPGRRPRTAALALRVCSTARPSRPAAVG*RR*TRARPTTTATTPSAS 559
             P P  +      +P R   T +    + S + P               P+TT  T    
Sbjct: 1324 TPEPTTTPDTTRTTPTRPTSTESTDTTMSSASTPE--------------PSTTPGT---- 1365

Query: 560  SRTWPAPPSRG-------SACCCPRAPSTRTAWSTSPTWPAGT--------SRATSRPTP 694
            +RT P  P+         S+   P   +T     T+PT P  T        S +T  PT 
Sbjct: 1366 TRTTPTRPTSTESTDTTMSSASTPEPSTTPGTTRTTPTRPTSTESTDTTMSSASTPEPTT 1425

Query: 695  PP-----IWPMPTSPSATPTSCWTCARPAPSCSGTSMRA--AWPT*PPAAAWTAWWRS*T 853
             P         PTS  +T T+  + + P PS +  + R     PT   +   T    S  
Sbjct: 1426 TPGTTRTTPTRPTSTESTDTTMSSASTPEPSTTPGTTRTTPTRPTSTESTDTTMSSASTP 1485

Query: 854  RPSTSCCWTRS------------RSSSARCWPTPTSPPSTTITSRT*TAPPAATAAAAAA 997
             PST+   TR+             + S+   P P+  P TT T+ T   P   T ++A+ 
Sbjct: 1486 EPSTTPGTTRTTPTRPTSTESTDTTMSSAYTPDPSGIPGTTRTTPTRPTPTETTMSSAST 1545

Query: 998  RRRGCPSPLCCPPWARCCSLRLVLCMRCATTASTRTCSARWCRPAWAPTPPS--WSPRSR 1171
                 P P   P   R    R        TT S+ +       P    T P+   S  S 
Sbjct: 1546 -----PEPSMTPGTTRTTPTRPTSTESTDTTMSSASTPEPSTTPGTTRTTPTRPTSTEST 1600

Query: 1172 TTTRLWTRSPARQWT-GCSRTTTT 1240
             TT     +P    T G +RTT T
Sbjct: 1601 DTTMSSASTPEPSTTPGTTRTTPT 1624

 Score = 56.2 bits (134), Expect = 1e-06
 Identities = 96/409 (23%), Positives = 141/409 (34%), Gaps = 11/409 (2%)
 Frame = +2

Query: 47   PSTIRAFDRNPALVDNADHGQGCSRC--------TRRSSACHPWTTRWRTSATWWARRRR 202
            P T R     P   ++ D     +          T R++   P +T    +    A    
Sbjct: 950  PGTTRTTPTRPTSTESTDTTMSSASTPEPSTTPGTTRTTPTRPTSTESTDTTMSSASTPE 1009

Query: 203  TRAEPWRS-ASPTAPASWAWGWETSSRRSRRRPSAASWAWRSCPA-PSRSSTAPPTSWCP 376
               +P  +  +PT P +      T S  S   PS      R+ P  P+ + +   T    
Sbjct: 1010 PSTKPGTTRTTPTRPTTTESTDTTMSSASTTEPSTTPGTTRTTPTRPTSTESTDTTMSSA 1069

Query: 377  VPPTPAPSAPWYPPSPGRRPRTAALALRVCSTARPSRPAAVG*RR*TRARPTTTATTPSA 556
              P P+ +      +P R   T +    + S + P               P+TT  T   
Sbjct: 1070 STPEPSTTPGTTRTTPTRPTSTESTDTTMSSASTPE--------------PSTTPGT--- 1112

Query: 557  SSRTWPAPPSRGSACCCPRAPSTRTAWSTSPTWPAGTSRATSRPTPPPIWPMPTSPSATP 736
             +RT P  P+           ST T  S++ T    T+  T+R TP      PTS  +T 
Sbjct: 1113 -TRTTPTRPT--------STESTDTTMSSASTPEPSTTPGTTRTTP----TRPTSTESTD 1159

Query: 737  TSCWTCARPAPSCSGTSMRAAWPT*PPAAAWTAWWRS*TRPSTSCCWTRSRSSSARCWPT 916
            T+  + + P PS +  + R   PT P               ST    T   S+S    P 
Sbjct: 1160 TTMSSASTPEPSTTPGTTRTT-PTRP--------------TSTESTDTTMSSAST---PE 1201

Query: 917  PTSPPSTTITSRT*TAPPAATAAAAAARRRGCPSPLCCPPWARCCSLRLVLCMRCATTAS 1096
            P++ P TT T  T T P +  +          P P   P   R    R        ++AS
Sbjct: 1202 PSTTPGTTRT--TPTRPTSTESTDTTMSSASTPEPSTTPGTTRTTPTRPTSTDTTMSSAS 1259

Query: 1097 TRTCSARWCRPAWAPTPPSWSPRSRTTTRLWTRSPARQWT-GCSRTTTT 1240
            T   S         PT P+ S  S  TT     +P    T G +RT+ T
Sbjct: 1260 TPEPSTTPGTTRTTPTRPT-STESTDTTMSSASTPEPSTTPGITRTSPT 1307

 Score = 50.8 bits (120), Expect = 5e-05
 Identities = 100/399 (25%), Positives = 137/399 (34%), Gaps = 60/399 (15%)
 Frame = +2

Query: 224  SASPTAPASWAWGWETSSRRSRRRPSAASWAWRSCPAPSRSSTAPPTSWCPVPPTPAPS- 400
            SAS   P++      T+  R     S  S +  S   P  S+T   T   P  PTP  S 
Sbjct: 2116 SASTPEPSTTPGTTRTTPTRPTSTDSTMSSSMSSASTPEPSTTPGTTRTTPTRPTPTDST 2175

Query: 401  -------APWYP----PSPGRRPRTAALALRVCSTARPSRPAAVG*RR*TRARPTTTATT 547
                   A   P     +P R   T +    + S + P      G  R T  RPT T +T
Sbjct: 2176 MSSSMSSASTTPGTTRTTPTRPTSTESTDTTMSSASTPEPSTTPGTTRTTPTRPTPTDST 2235

Query: 548  PSAS--SRTWPAPPSR-GSACCCPRAPS-TRTAWSTS--------PTWPAGTSRAT-SRP 688
             S+S  S + P P +  G+    P  P+ T T  S+S        P+   GT+R T +RP
Sbjct: 2236 MSSSMSSASTPEPSTTPGTTRTTPTRPTPTDTTMSSSMSSASTPEPSTTPGTTRTTPTRP 2295

Query: 689  TP-PPIWPMPTSPSATPTSCWTCA-------RPAPSCSGTSMRAAWPT*PPAAAWTAWWR 844
            TP         S ++TP S  T          P P C     +    + P         +
Sbjct: 2296 TPTDSTMSSSMSSASTPESSTTPELLQQDQHLPIPQCRLVCRQPLLRSHPRHLVQPELLQ 2355

Query: 845  S*TR-PSTSCCWTRSRS-----------------------SSARCWPTPTSPPSTTITSR 952
                 P   C     RS                        S+   P P++ P TT T+ 
Sbjct: 2356 QDQHLPIPQCRQPLLRSHLRHLVQPELLQQDQHLPSTDTTMSSASTPEPSTTPGTTRTTP 2415

Query: 953  T*TAPPAATAAAAAARRRGCPSPLCCPPWARCCSLRLVLCMRCATTASTRTCSARWCRPA 1132
            T   P  +T ++A+      P P   P   R    R        TT S+ +       P 
Sbjct: 2416 TRPTPTDSTMSSAST-----PEPSTTPGTTRTTPTRPTSTESTDTTMSSASTPEPSTTPG 2470

Query: 1133 WAPTPPS--WSPRSRTTTRLWTRSPARQWT-GCSRTTTT 1240
               T P+   S  S  TT     +P    T G +RTT T
Sbjct: 2471 TTRTTPTRPTSTESTDTTMSSASTPEPSTTPGTTRTTPT 2509

 Score = 47.8 bits (112), Expect = 4e-04
 Identities = 98/436 (22%), Positives = 145/436 (32%), Gaps = 38/436 (8%)
 Frame = +2

Query: 47   PSTIRAFDRNPALVDNADHGQGCSRCTRRSSACHPWTTRWRTSATWWARRRRTRAEPWRS 226
            P T R     P   ++ D     +     S+   P TTR  T+ T       T +    S
Sbjct: 2187 PGTTRTTPTRPTSTESTDTTMSSASTPEPSTT--PGTTR--TTPTRPTPTDSTMSSSMSS 2242

Query: 227  ASPTAPASWAWGWETSSRRSRRRPSAASWAWRSCPAPSRSSTAPPTSWCPVPPTP----- 391
            AS   P++      T+  R     +  S +  S   P  S+T   T   P  PTP     
Sbjct: 2243 ASTPEPSTTPGTTRTTPTRPTPTDTTMSSSMSSASTPEPSTTPGTTRTTPTRPTPTDSTM 2302

Query: 392  -----APSAPWYPPSPGRRPRTAALALRVCST--------ARPSRPAAVG*RR*TRARPT 532
                 + S P    +P    +   L +  C          + P         +  +  P 
Sbjct: 2303 SSSMSSASTPESSTTPELLQQDQHLPIPQCRLVCRQPLLRSHPRHLVQPELLQQDQHLPI 2362

Query: 533  TTATTPSASSRT--------------WPAPPSRGSACCCPRAPSTRTAWSTSPTWPAGT- 667
                 P   S                 P+  +  S+   P   +T     T+PT P  T 
Sbjct: 2363 PQCRQPLLRSHLRHLVQPELLQQDQHLPSTDTTMSSASTPEPSTTPGTTRTTPTRPTPTD 2422

Query: 668  SRATSRPTPPPIWPMPTSPSATPTSCWTCARPAPSCSGTSMRAAWPT*PPAAAWTAWWRS 847
            S  +S  TP P     T+P  T T   T  RP  + S  +  ++  T  P+        +
Sbjct: 2423 STMSSASTPEP----STTPGTTRT---TPTRPTSTESTDTTMSSASTPEPSTTPGTTRTT 2475

Query: 848  *TRPSTSCCWTRSRSSSARCWPTPTSPPSTTITSRT*TAPPAATAAAAAARRRGCPSPLC 1027
             TRP+++     + SS++   P P++ P TT T  T T P +  +          P P  
Sbjct: 2476 PTRPTSTESTDTTMSSAST--PEPSTTPGTTRT--TPTRPTSTESTDTTMTTASTPEPST 2531

Query: 1028 CPPWARCCSLRLVLCMRCATTASTRTCSARWCRPAWAP-----TPPSWSPRSRTTTRLWT 1192
             P   R    R        T   T   SA    P+  P     TP   +P   T +   T
Sbjct: 2532 TPDTTRTTPTR-------PTPTDTTMSSASTPEPSTTPGTTRTTPTRPTPTDTTMSSAST 2584

Query: 1193 RSPARQWTGCSRTTTT 1240
              P+    G +RTT T
Sbjct: 2585 PEPSTT-PGTTRTTPT 2599

 Score = 44.7 bits (104), Expect = 0.004
 Identities = 61/240 (25%), Positives = 88/240 (36%), Gaps = 24/240 (10%)
 Frame = +2

Query: 593  SACCCPRAPSTRTAWSTSPTWPAGT--------SRATSRP--TPPPIWPMPTSPSATPTS 742
            S+   P   +T     T+PT P  T        S +T  P  TP      PT P+ T ++
Sbjct: 4    SSASTPEPSTTPGTTRTTPTRPTSTESTDTTMSSASTPEPSTTPGTTRTTPTRPTPTDST 63

Query: 743  CWTCARPAPSCSGTSMRAAWPT*PPAAAWTAWWRS*TRPSTSCCWTRS---------RSS 895
              + + P PS +  + R   PT P     T        PS++   TR+          + 
Sbjct: 64   MSSASTPEPSTTPGTTRTT-PTRPTPTDTTMSSAYTPDPSSTPGTTRTTPTRQTPTDTTM 122

Query: 896  SARCWPTPTSPPSTTITSRT*TAPPAATAAAAAARRRGCPSPLCCPPWARCCSLRLVLCM 1075
            S+   P P++ P TT T+ T   P   T ++A+      P P   P   R    R     
Sbjct: 123  SSASTPQPSTTPGTTRTTPTRPTPTDTTMSSAST-----PEPSTTPGTTRTTPTR----- 172

Query: 1076 RCATTASTRTCSARWCRPAWAP-----TPPSWSPRSRTTTRLWTRSPARQWTGCSRTTTT 1240
               T   T   S     P+  P     TP   +P   T +   T  P+    G +RTT T
Sbjct: 173  --PTPTDTTMSSESTPEPSTTPGTTRTTPTRPTPTDTTMSSASTPEPSTT-PGTTRTTPT 229

>dbj|BAC87637.1| unnamed protein product [Homo sapiens]
          Length = 286

 Score = 79.3 bits (194), Expect = 1e-13
 Identities = 102/292 (34%), Positives = 116/292 (38%), Gaps = 9/292 (3%)
 Frame = +2

Query: 194  RRRTRAEPWRS---ASPTAPASWAWGWETSSRRSRRRPSAASWAWRSCPAPSRSSTAPPT 364
            R  TRA P R    ASPT     A    T  R S RR             P  S T PPT
Sbjct: 29   RPPTRASPTRMPPRASPTRTPPRASPRRTPPRASPRRTP-----------PRASLTRPPT 77

Query: 365  SWCP--VPPTPAPSAPWYPPSPGRRPRTAALALRVCSTARPSRPAAVG*RR*TRARPTTT 538
               P  +PPT  P+      SP R P T + A R   TA P+R         T  R + T
Sbjct: 78   RAPPTRMPPTAPPTRTPPTASPARTPPTESPA-RTPPTASPAR---------TPPRASPT 127

Query: 539  ATTPSASSRTWP--APPSRGSACCCPRAPSTRTAWSTSPTWPAGTSRATSRPTPPPIWPM 712
             T P AS R  P  A P+R      PRA   RT    SPT      RA+ + TPP   P 
Sbjct: 128  RTPPRASPRRTPSTASPTRTP----PRASPRRTPPRASPT--RTPPRASPKRTPPRASPR 181

Query: 713  PTSPSATPTSCWTCARPAPSCSGTSMRAAWPT*PPAAAWTAWWRS*TRPSTSCCWTRSRS 892
             T P A+PT     A P  S   T   A+    PP A+ T      T P+ S   T  R+
Sbjct: 182  RTPPRASPTR----APPRASPKRTPPTASPTRTPPRASPTR-----TPPTESPARTPPRA 232

Query: 893  SSARCWPT--PTSPPSTTITSRT*TAPPAATAAAAAARRRGCPSPLCCPPWA 1042
            S  R  PT  P   PS   T RT   PP A+      R     SP   PP A
Sbjct: 233  SPTRTPPTESPARTPSRASTRRT---PPRASPTRTPPR----ASPKRTPPTA 277

 Score = 52.4 bits (124), Expect = 2e-05
 Identities = 82/271 (30%), Positives = 99/271 (36%), Gaps = 23/271 (8%)
 Frame = +2

Query: 515  TRARPTTTATTPSASSRTWPAPPSRGSACCCPRAPSTRTAWSTSPTWPAGTSRATSRPTP 694
            TR   TT+ T P   +     PP        PRA   RT    SP      +  T  PT 
Sbjct: 19   TRILYTTSLTRPPTRASPTRMPPRASPTRTPPRASPRRTPPRASPRRTPPRASLTRPPTR 78

Query: 695  PPIWPMPTSPSATPTSCWTCARPAPSCSGTSMRAAWPT*PPAAAWTAWWRS*TRPSTSCC 874
             P   MP  P+A PT     A PA +    S     PT  PA        + T P  S  
Sbjct: 79   APPTRMP--PTAPPTRTPPTASPARTPPTESPARTPPTASPARTPPRASPTRTPPRASPR 136

Query: 875  WTRSRSSSARCWPTPT---SPPSTTITSRT*TAPPAATAAAAAARR---RGCP------- 1015
             T S +S  R  P  +   +PP  + T     A P  T   A+ RR   R  P       
Sbjct: 137  RTPSTASPTRTPPRASPRRTPPRASPTRTPPRASPKRTPPRASPRRTPPRASPTRAPPRA 196

Query: 1016 SPLCCPPWARCCSLRLVLCMRCATTASTRTCSARWCRPAWAP--TPPSWSPRSRTTTRLW 1189
            SP   PP A           R + T +  T S     P  +P  TPP+ SP +RT +R  
Sbjct: 197  SPKRTPPTASPTRTP----PRASPTRTPPTESPARTPPRASPTRTPPTESP-ARTPSRAS 251

Query: 1190 TR------SPARQWTGCS--RTTTTACAACC 1258
            TR      SP R     S  RT  TA    C
Sbjct: 252  TRRTPPRASPTRTPPRASPKRTPPTASPTSC 282

>gb|AAK31375.1|AC084329_1 ppg3 [Leishmania major]
          Length = 1325

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 82/341 (24%), Positives = 161/341 (47%), Gaps = 12/341 (3%)
 Frame = +2

Query: 266  ETSSRRSRRRPSAASWAWRSCPAPSRSSTAPPTSWCPVPPTPAPSAPWYPPSPGRRPRTA 445
            ET S  S    S++S +  S  APS SS++ P+S    P   + SA   P S    P  +
Sbjct: 663  ETESSSSAPSASSSSASSSSSSAPSASSSSAPSSSSSAPSASSSSA---PSSSSSAPSAS 719

Query: 446  ALALRVCSTARPSRPAAVG*RR*TRARPTTTATTPSASSRTWPAPPSRGSACCCPRAPST 625
            + +    S++ PS  ++        + P+++++ PSASS + P+  S   +     APS+
Sbjct: 720  SSSAPSSSSSAPSASSS--------SAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSS 771

Query: 626  RTAWSTSPTWPAGTSRATSRP----TPPPIWPMPTSPSATPTSCWTCARPAPSCSGTSMR 793
             ++ + S +  +  S ++S P    +  P     ++PSA+ +S  + +  APS S +S  
Sbjct: 772  SSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAP 831

Query: 794  AAWPT*PPAAAWTAWWRS*TRPSTSCCWTRSRSSSARCWPTPTSPPSTTI--TSRT*TAP 967
            ++  + P A++ +A   S + PS S     S SSSA    + ++P S++   ++ + +AP
Sbjct: 832  SSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAP 891

Query: 968  PAATAAAAAARRRGCPS------PLCCPPWARCCSLRLVLCMRCATTASTRTCSARWCRP 1129
             +++++A +A     PS      P      A   S         ++  S+ + SA     
Sbjct: 892  SSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASS 951

Query: 1130 AWAPTPPSWSPRSRTTTRLWTRSPARQWTGCSRTTTTACAA 1252
            + AP+  S +P + +++   + S A   +  S  ++++ +A
Sbjct: 952  SSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSA 992

 Score = 78.6 bits (192), Expect = 2e-13
 Identities = 93/357 (26%), Positives = 169/357 (47%), Gaps = 7/357 (1%)
 Frame = +2

Query: 224  SASPTAPASWAWGWETS--SRRSRRRPSAASWA--WRSCPAPSRSSTAPPTSWCPVPPTP 391
            S++P+A +S A    +S  S  S   PS++S A    S  APS SS+AP  S    P + 
Sbjct: 713  SSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSS 772

Query: 392  APSAPWYPPSPGRRPRTAALALRVCSTARPSRPAAVG*RR*TRARPTTTATTPSASSRTW 571
            + SAP    S    P +++ A    S++ PS  ++      + + P+++++ PSASS + 
Sbjct: 773  SSSAP--SASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSS- 829

Query: 572  PAPPSRGSACCCPRAPSTRTAWSTSPTWPAGTSRATSRPTPPPIWPMPTSPSATPTSCWT 751
             AP S  SA   P A S+    S+S    A +S A S  +  P     ++PS++ ++   
Sbjct: 830  -APSSSSSA---PSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSA 885

Query: 752  CARPAPSCSGTSMRAAWPT*PPAAAWTAWWRS*TRPSTSCCWTRSRSSSARCWPTPTSPP 931
             +  APS S +S  +A  +  P+++      S + PS S     S SSS+    + +S P
Sbjct: 886  SSSSAPSSSSSSAPSASSSSAPSSS------SSSAPSASSSSAPSSSSSSAPSASSSSAP 939

Query: 932  STTIT---SRT*TAPPAATAAAAAARRRGCPSPLCCPPWARCCSLRLVLCMRCATTASTR 1102
            S++ +   S + ++ P+++++A +A     PS     P A   S             S+ 
Sbjct: 940  SSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSS-----------APSSS 988

Query: 1103 TCSARWCRPAWAPTPPSWSPRSRTTTRLWTRSPARQWTGCSRTTTTACAACCCATAA 1273
            + SA     + AP+  S +P + +++   + S A   +  S  ++++ A    +++A
Sbjct: 989  SSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSA 1045

 Score = 76.6 bits (187), Expect = 8e-13
 Identities = 74/273 (27%), Positives = 136/273 (49%), Gaps = 8/273 (2%)
 Frame = +2

Query: 224  SASPTAPASWAWGWETSSRRSRRRPSAASWAWRSCPAPSRSSTAPPTSWCPVPPTPAPSA 403
            S++P+A +S A    +SS  S    S++S    S  APS SS++ P+S    P   + SA
Sbjct: 668  SSAPSASSSSA----SSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSA 723

Query: 404  PWYPPSP-----GRRPRTAALALRVCSTARPSRPAAVG*RR*TRARPTTTATTPSASSRT 568
            P    S         P +++ A    S++ PS  ++      + A  +++++ PSASS +
Sbjct: 724  PSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSS 783

Query: 569  WPAPPSRGSACCCPRAPSTRTA---WSTSPTWPAGTSRATSRPTPPPIWPMPTSPSATPT 739
             P+  S   +     APS+ ++    ++S + P+ +S A S  +        ++PSA+ +
Sbjct: 784  APSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSS 843

Query: 740  SCWTCARPAPSCSGTSMRAAWPT*PPAAAWTAWWRS*TRPSTSCCWTRSRSSSARCWPTP 919
            S  + +  APS S +S  ++  + P A++ +A   S + PS S     S SSS+    + 
Sbjct: 844  SAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASS 903

Query: 920  TSPPSTTITSRT*TAPPAATAAAAAARRRGCPS 1018
            +S PS++ +S    AP A++++A ++     PS
Sbjct: 904  SSAPSSSSSS----APSASSSSAPSSSSSSAPS 932

 Score = 73.2 bits (178), Expect = 9e-12
 Identities = 81/327 (24%), Positives = 154/327 (46%), Gaps = 8/327 (2%)
 Frame = +2

Query: 224  SASPTAPASWAWGWETSSRRSRRRPSAASWAWRSCPAPSRSSTAPPTSWCPVPPTPAPSA 403
            S+S +AP++ +    +SS  S    S++S    S  APS SS++ P+S    P   + SA
Sbjct: 786  SSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSA 845

Query: 404  PWYPPSPGRRPRTAALALRVCSTARPSRPAAVG*RR*TRARPTTTATTPSASSRTWP--- 574
            P    S    P  ++ +    S++ PS  ++        + P+++++ PSASS + P   
Sbjct: 846  P---SSSSSAPSASSSSAPSSSSSAPSASSS--------SAPSSSSSAPSASSSSAPSSS 894

Query: 575  ---APPSRGSACCCPRAPSTRTAWSTSPTWPAGTSRATSRPTPPPIWPMPTSPSATPTSC 745
               AP +  S+     + S  +A S+S    + +S  ++  +  P     ++PSA+ +S 
Sbjct: 895  SSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSA 954

Query: 746  WTCARPAPSCSGTSMRAAWPT*PPAAAWTA-WWRS*TRPSTSCCWTRSRSSSARCWPTPT 922
             + +  APS S +S  ++  + P A++ +A    S + PS S     S SSSA    + +
Sbjct: 955  PSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSS 1014

Query: 923  SP-PSTTITSRT*TAPPAATAAAAAARRRGCPSPLCCPPWARCCSLRLVLCMRCATTAST 1099
            +P  S++  S + ++ P+++++A +A     PS     P A   S             S+
Sbjct: 1015 APSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSS-----------APSS 1063

Query: 1100 RTCSARWCRPAWAPTPPSWSPRSRTTT 1180
             + SA     + AP+  S +P + +++
Sbjct: 1064 SSSSAPSASSSSAPSSSSSAPSASSSS 1090

 Score = 70.9 bits (172), Expect = 5e-11
 Identities = 72/271 (26%), Positives = 134/271 (48%), Gaps = 6/271 (2%)
 Frame = +2

Query: 224  SASPTAPASWAWGWETSSRRSRRRPSAASWAWRSCPAPSRSSTAPPTSWCPVPPTPAPSA 403
            S++P+A +S A     SS  S    S++S    S  APS SS++ P+S    P   + SA
Sbjct: 835  SSAPSASSSSA----PSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSA 890

Query: 404  PWYPPSPGRRPRTAALALRVCSTARPSRPAAVG*RR*TRARPTTTATTPSASSRTWPAPP 583
            P    S       +A +    S++  S P+A      + A  +++++ PSASS + P+  
Sbjct: 891  P----SSSSSSAPSASSSSAPSSSSSSAPSASS----SSAPSSSSSSAPSASSSSAPSSS 942

Query: 584  SRG----SACCCPRAPSTRTAWSTSPTWPAGTSRATSRPTPPPIWPMPTSPSATPTSCWT 751
            S      S+   P + S+  + S+S    + +S  ++  +  P     ++PSA+ +S  +
Sbjct: 943  SSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPS 1002

Query: 752  CARPAPSCSGTSMRAAWPT*PPAAAWTAWWRS*TRPSTSCCWTRSRSSSARCWPTPTSPP 931
             +  APS S +S  ++  + P A++ +A   S + PS S     S SSSA    + ++P 
Sbjct: 1003 SSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPS 1062

Query: 932  STTIT--SRT*TAPPAATAAAAAARRRGCPS 1018
            S++ +  S + ++ P+++++A +A     PS
Sbjct: 1063 SSSSSAPSASSSSAPSSSSSAPSASSSSAPS 1093

 Score = 69.3 bits (168), Expect = 1e-10
 Identities = 78/310 (25%), Positives = 147/310 (47%), Gaps = 3/310 (0%)
 Frame = +2

Query: 77   PALVDNADHGQGCSRCTRRSSACHPWTTRWRTSATWWARRRRTRAEPWRSASPTAPASWA 256
            P+   ++      S     SS+  P ++    SA+  +    + + P  S+S +AP+S +
Sbjct: 792  PSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSS-SAPSSSS 850

Query: 257  WGWETSSRRSRRRPSAASWAWRSCPAPSRSSTAPPTSWCPVPPTPAPSAPWYPPSPGRRP 436
                 SS  +    S+A  A  S  APS SS+AP  S    P + + SAP    S     
Sbjct: 851  SAPSASSSSAPSSSSSAPSA-SSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSS 909

Query: 437  RTAALALRVCSTARPSRPAAVG*RR*TRARPTTTATTPSASSRTWPAPPSRGSACCCPRA 616
             +++      S+A  S  ++      + A  +++++ PSASS + P+  S   +     A
Sbjct: 910  SSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSA 969

Query: 617  PSTRTAWSTSPTWPAGTSRATSRPTPPPIWPMPTS---PSATPTSCWTCARPAPSCSGTS 787
            PS+ ++  ++ +  A +S ++S P+        +S   PSA+ +S  + +  APS S +S
Sbjct: 970  PSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSS 1029

Query: 788  MRAAWPT*PPAAAWTAWWRS*TRPSTSCCWTRSRSSSARCWPTPTSPPSTTITSRT*TAP 967
              ++  + P A++ +A   S + PS S     S SSS+    + +S PS++      +AP
Sbjct: 1030 APSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSS-----SAP 1084

Query: 968  PAATAAAAAA 997
             A++++A ++
Sbjct: 1085 SASSSSAPSS 1094

 Score = 64.7 bits (156), Expect = 3e-09
 Identities = 64/243 (26%), Positives = 119/243 (48%), Gaps = 4/243 (1%)
 Frame = +2

Query: 224  SASPTAPASWAWGWETSSRRSRRRPSAASWAWRSCPAPSRSSTAPPTSWCPVPPTPAPSA 403
            ++S +AP+S +     SS  +    S+A  A  S    S SS+AP  S    P + + SA
Sbjct: 855  ASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSA 914

Query: 404  PWYPPSPGRRPRTAALALRVCSTARPSRPAAVG*RR*TRARPTTTATTPSASSRTWPAPP 583
            P    S      +++ A    S++ PS  ++      + + P+++++ PSASS + P+  
Sbjct: 915  P-SASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSS 973

Query: 584  SRGSACCCPRAPSTRTAWS---TSPTWPAGTSRATSRPTPPPIWPMPTSPSATPTSCWTC 754
            S   +     APS+ ++ +   +S + P+ +S A S  +        ++PSA+ +S  + 
Sbjct: 974  SSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSS 1033

Query: 755  ARPAPSCSGTSMRAAWPT*PPAAAWTA-WWRS*TRPSTSCCWTRSRSSSARCWPTPTSPP 931
            +  APS S +S  ++  + P A++ +A    S + PS S     S SSSA    + ++P 
Sbjct: 1034 SSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPS 1093

Query: 932  STT 940
            S++
Sbjct: 1094 SSS 1096

 Score = 50.8 bits (120), Expect = 5e-05
 Identities = 57/252 (22%), Positives = 120/252 (47%), Gaps = 4/252 (1%)
 Frame = +2

Query: 530  TTTATTPSA-SSRTWPAPPSRGSACCCPRAPSTRTAWSTSPTWPAGTSRATSRPTPPPIW 706
            T  A  P   SS + P+  S  ++     APS  ++ + S +  A ++ ++S P+     
Sbjct: 656  TENACKPETESSSSAPSASSSSASSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSS-- 713

Query: 707  PMPTSPSATPTSCWTCARPAPSCSGTSMRAAWPT*PPAAAWTAWWRS*TRPSTSCCWTRS 886
               ++PSA+ +S  + +  APS S +S  ++  + P A++ +A   S + PS S     S
Sbjct: 714  ---SAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPS 770

Query: 887  RSSSARCWPTPTSPPSTTI---TSRT*TAPPAATAAAAAARRRGCPSPLCCPPWARCCSL 1057
             SSS+    + +S PS++    ++ + +AP +++++A +A     PS     P A     
Sbjct: 771  SSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSA----- 825

Query: 1058 RLVLCMRCATTASTRTCSARWCRPAWAPTPPSWSPRSRTTTRLWTRSPARQWTGCSRTTT 1237
                    +++A + + SA     + AP+  S +P + +++   + S A   +  S  ++
Sbjct: 826  -------SSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSS 878

Query: 1238 TACAACCCATAA 1273
            ++ A    +++A
Sbjct: 879  SSSAPSASSSSA 890

 Score = 46.6 bits (109), Expect = 0.001
 Identities = 71/323 (21%), Positives = 115/323 (34%)
 Frame = -3

Query: 1079 TSYTTPAAMSSNAPTVGSTMAMGSHDGEPPPPPPSPPAVPFRFWMLL*LMVAR*VSASSE 900
            +S + P++ SS+AP+  S+ A  S    P     S P+                 SA S 
Sbjct: 795  SSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSS--------------SAPSA 840

Query: 899  RNCFCCGSSSSL*KVWFMSATTLSTLLPVVRLARPLS*MSLNSLVPGVRRSSTMLGWLKD 720
             +     SSSS       SA + S+  P    A   S  S +S  P    SS        
Sbjct: 841  SSSSAPSSSSSAPSASSSSAPSSSSSAPS---ASSSSAPSSSSSAPSASSSSA------- 890

Query: 719  SLAWAR*AAVSAGS*PDSFQRARLEKCSRRYGSKELSGSSTRCHDSAGLARCEKKPME*L 540
                    + S+ S P +   +     S    S   S + +    SA  A     P    
Sbjct: 891  -------PSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPS--- 940

Query: 539  R*SLGVRAFTAATQPPPAAKGARLSTRVMLGPPSEADGPGWAGTTVPKGQVSAAQGTSWL 360
              S    A +A++   P++  +  S      P S +  P  + ++ P    S+A   S  
Sbjct: 941  --SSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSS 998

Query: 359  EVRLRTSKEPGMSATPSLPRKGDVLNALKKSPSPTPMRQVPLAKRCAMARPASAGAAPTT 180
                 +S  P  S++ S P       +   S +P+     P A   + + P+S+ +AP+ 
Sbjct: 999  SAPSSSSSAPSASSS-SAPSSSSSAPSASSSSAPSSSSSAPSAS--SSSAPSSSSSAPSA 1055

Query: 179  SHLSSTL*SMGDRPMSAEYSVSS 111
            S  S+   S    P ++  S  S
Sbjct: 1056 SSSSAPSSSSSSAPSASSSSAPS 1078

 Score = 45.4 bits (106), Expect = 0.002
 Identities = 37/138 (26%), Positives = 68/138 (48%)
 Frame = +2

Query: 224  SASPTAPASWAWGWETSSRRSRRRPSAASWAWRSCPAPSRSSTAPPTSWCPVPPTPAPSA 403
            S+S +AP++ +    +SS  S    S++S    S  APS SS++ P+S    P   + SA
Sbjct: 971  SSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSA 1030

Query: 404  PWYPPSPGRRPRTAALALRVCSTARPSRPAAVG*RR*TRARPTTTATTPSASSRTWPAPP 583
            P    S    P  ++ +    S++ PS  ++        A  +++++ PSASS + P+  
Sbjct: 1031 P---SSSSSAPSASSSSAPSSSSSAPSASSS-------SAPSSSSSSAPSASSSSAPSSS 1080

Query: 584  SRGSACCCPRAPSTRTAW 637
            S   +     APS+ +++
Sbjct: 1081 SSAPSASSSSAPSSSSSF 1098

 Score = 45.1 bits (105), Expect = 0.003
 Identities = 85/387 (21%), Positives = 140/387 (35%)
 Frame = -3

Query: 1271 PLWRSSRRRRQSLWSLSSRSTASLESASTIWL*SWISVTRMVVSGPTPGGTTLPNRFLCL 1092
            P   SS     S  + S+ S+++  S+S+    S  S      S P+   ++ P+     
Sbjct: 701  PSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPS----- 755

Query: 1091 RLLRTSYTTPAAMSSNAPTVGSTMAMGSHDGEPPPPPPSPPAVPFRFWMLL*LMVAR*VS 912
                +S + P+A SS+AP+  S+ A  +     P    S P+             +   S
Sbjct: 756  ----SSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSS-----APSSSSSS 806

Query: 911  ASSERNCFCCGSSSSL*KVWFMSATTLSTLLPVVRLARPLS*MSLNSLVPGVRRSSTMLG 732
            A S  +     SSSS       SA + S+  P    A   S  S +S  P    SS    
Sbjct: 807  APSASSSSAPSSSSSAPSASSSSAPSSSSSAP---SASSSSAPSSSSSAPSASSSSAPSS 863

Query: 731  WLKDSLAWAR*AAVSAGS*PDSFQRARLEKCSRRYGSKELSGSSTRCHDSAGLARCEKKP 552
                  A +  A  S+ S P +   +     S    S   S + +    SA  A     P
Sbjct: 864  SSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAP 923

Query: 551  ME*LR*SLGVRAFTAATQPPPAAKGARLSTRVMLGPPSEADGPGWAGTTVPKGQVSAAQG 372
                  S       +++  P ++  +  S      P S +  P  + ++ P    SA   
Sbjct: 924  SS----SSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSA 979

Query: 371  TSWLEVRLRTSKEPGMSATPSLPRKGDVLNALKKSPSPTPMRQVPLAKRCAMARPASAGA 192
            +S       +S  P  S++ S P       +   S +P+     P A   + + P+S+ +
Sbjct: 980  SSSSAPSSSSSSAPSASSS-SAPSSSSSAPSASSSSAPSSSSSAPSAS--SSSAPSSSSS 1036

Query: 191  APTTSHLSSTL*SMGDRPMSAEYSVSS 111
            AP+ S  SS   S    P ++  S  S
Sbjct: 1037 APSASS-SSAPSSSSSAPSASSSSAPS 1062

 Score = 40.8 bits (94), Expect = 0.052
 Identities = 32/116 (27%), Positives = 60/116 (51%), Gaps = 1/116 (0%)
 Frame = +2

Query: 674  ATSRPTPPPIWPMPTSPSATPTSCWTCARPAPSCSGTSMRAAWPT*PPAAAWTAWWRS*T 853
            AT     P      ++PSA+ +S  + +  APS S +S  ++  + P A++ +A   S +
Sbjct: 655  ATENACKPETESSSSAPSASSSSASSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSS 714

Query: 854  RPSTSCCWTRSRSSSARCWPTPTSP-PSTTITSRT*TAPPAATAAAAAARRRGCPS 1018
             PS S     S SSSA    + ++P  S++  S + ++ P+++++A +A     PS
Sbjct: 715  APSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPS 770

 Score = 38.9 bits (89), Expect = 0.20
 Identities = 69/323 (21%), Positives = 115/323 (35%)
 Frame = -3

Query: 1079 TSYTTPAAMSSNAPTVGSTMAMGSHDGEPPPPPPSPPAVPFRFWMLL*LMVAR*VSASSE 900
            +S + P+A SS+AP+  S+    S    P     +P A                 S+SS 
Sbjct: 681  SSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSA-----------------SSSSA 723

Query: 899  RNCFCCGSSSSL*KVWFMSATTLSTLLPVVRLARPLS*MSLNSLVPGVRRSSTMLGWLKD 720
             +     SSSS       SA + S+  P    A   S  S +S  P    SS        
Sbjct: 724  PS-----SSSSAPSASSSSAPSSSSSAP---SASSSSAPSSSSSAPSASSSSAPSSSSSS 775

Query: 719  SLAWAR*AAVSAGS*PDSFQRARLEKCSRRYGSKELSGSSTRCHDSAGLARCEKKPME*L 540
            + + +  +A S+ S   S   +     S        S S+     SA  A     P    
Sbjct: 776  APSASSSSAPSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSAPSASSSSAP---- 831

Query: 539  R*SLGVRAFTAATQPPPAAKGARLSTRVMLGPPSEADGPGWAGTTVPKGQVSAAQGTSWL 360
              S    A +A++   P++  +  S      P S +  P  + ++ P    SA   +S  
Sbjct: 832  --SSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASSSSAPSSSSSAPSASS-- 887

Query: 359  EVRLRTSKEPGMSATPSLPRKGDVLNALKKSPSPTPMRQVPLAKRCAMARPASAGAAPTT 180
                  S  P  S++ +         +   S +P+       +   + A  AS+ +AP++
Sbjct: 888  ------SSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSSSSSSAPSASSSSAPSS 941

Query: 179  SHLSSTL*SMGDRPMSAEYSVSS 111
            S  S+   S    P S+  + S+
Sbjct: 942  SSSSAPSASSSSAPSSSSSAPSA 964

>gb|AAA59163.1| mucin
          Length = 1270

 Score = 77.8 bits (190), Expect = 4e-13
 Identities = 89/308 (28%), Positives = 118/308 (37%), Gaps = 13/308 (4%)
 Frame = +2

Query: 335  PSRSSTAPPTSWCPVPPTPAPSAPWYPP----------SPGRRPRTAALALRVCSTARPS 484
            P+ ++T PP +  P PPT   + P  PP          +P   P T         T  PS
Sbjct: 901  PTTTTTTPPPTTTPSPPT---TTPITPPTSTTTLPPTTTPSPPPTTTTTP---PPTTTPS 954

Query: 485  RPAAVG*RR*TRARPTTTATTPSASSRTWPAPPSRGSACCCP-RAPSTRTAWSTSPTWPA 661
             P        T + PT T TTP  +  T P+PP+  +    P   PS  T    +P    
Sbjct: 955  PPTTT-----TPSPPTITTTTPPPT--TTPSPPTTTTTTPPPTTTPSPPTTTPITPPTST 1007

Query: 662  GTSRATSRPTPPPIWPMPTSPSATPTSCWTCARPAPSCSGTSMRAAWPT*PPAAAWTAWW 841
             T   T+ P+PPP       P+ TP S  T   P+P  + T+      T PP        
Sbjct: 1008 TTLPPTTTPSPPPTTTTTPPPTTTP-SPPTTTTPSPPITTTT------TPPPT------- 1053

Query: 842  RS*TRPSTSCCWTRSRSSSARCWPTPTSPPSTTITSRT*TAPPAATAAAAAARRRGCPSP 1021
               T PS+    T S  ++    P+PT+ PS+ IT  T T P + T  +        PSP
Sbjct: 1054 ---TTPSSPITTTPSPPTTTMTTPSPTTTPSSPIT--TTTTPSSTTTPSPPPTTMTTPSP 1108

Query: 1022 LCCPPWARCCSLRLVLCMRCATTASTRTCSARWCRPAWAP--TPPSWSPRSRTTTRLWTR 1195
               P                 TT    T S+        P  TPP++SP S TTT     
Sbjct: 1109 TTTPSPP----------TTTMTTLPPTTTSSPLTTTPLPPSITPPTFSPFS-TTTPTTPC 1157

Query: 1196 SPARQWTG 1219
             P   WTG
Sbjct: 1158 VPLCNWTG 1165

 Score = 73.6 bits (179), Expect = 7e-12
 Identities = 90/311 (28%), Positives = 122/311 (38%), Gaps = 7/311 (2%)
 Frame = +2

Query: 329  PAPSRSSTAPPTSWCPVPPTPAPSAPWYPPSPGRRPRTAALALRVCSTARPSRPAAVG*R 508
            P P+ ++T PPT+  P PPT   + P  PP+    P        +  T  PS P +    
Sbjct: 783  PPPTTTTTLPPTT-TPSPPTTTTTTP--PPTTTPSPPITTTTTPL-PTTTPSPPISTT-- 836

Query: 509  R*TRARPTTT----ATTPSASSRTWPAPPSRGSACCCPRAPSTRTAWSTSP-TWPAGTSR 673
              T   PTTT     TTPS  + T P+PP+  +    P   +T +   T+P T PA T+ 
Sbjct: 837  --TTPPPTTTPSPPTTTPSPPTTT-PSPPT--TTTTTPPPTTTPSPPMTTPITPPASTTT 891

Query: 674  --ATSRPTPPPIWPMPTSPSATPTSCWTCARPAPSCSGTSMRAAWPT*PPAAAWTAWWRS 847
               T+ P+PP        P+ TP+   T     P+ + T      P+ PP    T     
Sbjct: 892  LPPTTTPSPPTTTTTTPPPTTTPSPPTTTPITPPTSTTTLPPTTTPSPPPTTTTTP--PP 949

Query: 848  *TRPSTSCCWTRSRSSSARCWPTPTSPPSTTITSRT*TAPPAATAAAAAARRRGCPSPLC 1027
             T PS     T S  +     P PT+ PS   T+ T T PP  T           PSP  
Sbjct: 950  TTTPSPPTTTTPSPPTITTTTPPPTTTPSPPTTTTT-TPPPTTT-----------PSPPT 997

Query: 1028 CPPWARCCSLRLVLCMRCATTASTRTCSARWCRPAWAPTPPSWSPRSRTTTRLWTRSPAR 1207
              P     S      +   TT S    +     P   P+PP+ +  S   T   T +P  
Sbjct: 998  TTPITPPTS---TTTLPPTTTPSPPPTTTTTPPPTTTPSPPTTTTPSPPITT--TTTPPP 1052

Query: 1208 QWTGCSRTTTT 1240
              T  S  TTT
Sbjct: 1053 TTTPSSPITTT 1063

 Score = 72.4 bits (176), Expect = 2e-11
 Identities = 87/323 (26%), Positives = 117/323 (35%), Gaps = 19/323 (5%)
 Frame = +2

Query: 329  PAPSRSSTAPPTSWCPVPPTPAPSAPWYPPSPGRRPRTAALALRVCSTARPSRPAAVG*R 508
            P P+ + + P ++    PPT  PS P   PSP   P T        +T  P         
Sbjct: 823  PLPTTTPSPPISTTTTPPPTTTPSPPTTTPSP---PTTTPSPPTTTTTTPPPTT------ 873

Query: 509  R*TRARPTTTATTPSASS-----RTWPAPPSRGSACCCP-RAPSTRTAWSTSPTWPAGTS 670
              T + P TT  TP AS+      T P+PP+  +    P   PS  T    +P     T 
Sbjct: 874  --TPSPPMTTPITPPASTTTLPPTTTPSPPTTTTTTPPPTTTPSPPTTTPITPPTSTTTL 931

Query: 671  RATSRPTPPPIWPMPTSPSATPTSCWTCARPAPSCSGTSMRAAWPT*PPAAAWTAWWRS* 850
              T+ P+PPP       P+ TP S  T   P+P    T+      T  P    T      
Sbjct: 932  PPTTTPSPPPTTTTTPPPTTTP-SPPTTTTPSPPTITTTTPPPTTTPSPPTTTTTTPPPT 990

Query: 851  TRPSTSCCWTRSRSSSARCWP---TPTSPPSTTIT--SRT*TAPPAATAAAAAARRRGCP 1015
            T PS       +  +S    P   TP+ PP+TT T    T  +PP  T  +        P
Sbjct: 991  TTPSPPTTTPITPPTSTTTLPPTTTPSPPPTTTTTPPPTTTPSPPTTTTPSPPITTTTTP 1050

Query: 1016 SPLCCPPWARCCSLRLVLCMRCATTASTRTCSARWCRPAWAPTPP---SWSPRSRTT--- 1177
             P   P                 TT S  T +     P   P+ P   + +P S TT   
Sbjct: 1051 PPTTTP------------SSPITTTPSPPTTTMTTPSPTTTPSSPITTTTTPSSTTTPSP 1098

Query: 1178 --TRLWTRSPARQWTGCSRTTTT 1240
              T + T SP    +  + T TT
Sbjct: 1099 PPTTMTTPSPTTTPSPPTTTMTT 1121

 Score = 54.3 bits (129), Expect = 5e-06
 Identities = 58/236 (24%), Positives = 87/236 (36%), Gaps = 3/236 (1%)
 Frame = +2

Query: 542  TTPSASSRTWPAPPSRGSACCCPRAPSTRTAWSTSPTWPAGTSRATSRPTPP---PIWPM 712
            TTPS  + T   PP+  +       PS  T  +T+P         T+ P+PP      P+
Sbjct: 772  TTPSPPTTTPSPPPTTTTTLPPTTTPSPPTTTTTTPP-------PTTTPSPPITTTTTPL 824

Query: 713  PTSPSATPTSCWTCARPAPSCSGTSMRAAWPT*PPAAAWTAWWRS*TRPSTSCCWTRSRS 892
            PT+  + P S  T   P  + S  +   + PT  P+            P+T+       +
Sbjct: 825  PTTTPSPPISTTTTPPPTTTPSPPTTTPSPPTTTPSP-----------PTTTTTTPPPTT 873

Query: 893  SSARCWPTPTSPPSTTITSRT*TAPPAATAAAAAARRRGCPSPLCCPPWARCCSLRLVLC 1072
            + +    TP +PP++T T    T P   T           PSP    P     S      
Sbjct: 874  TPSPPMTTPITPPASTTTLPPTTTPSPPTTTTTTPPPTTTPSPPTTTPITPPTS---TTT 930

Query: 1073 MRCATTASTRTCSARWCRPAWAPTPPSWSPRSRTTTRLWTRSPARQWTGCSRTTTT 1240
            +   TT S    +     P   P+PP+ +  S  T    T  P    +  + TTTT
Sbjct: 931  LPPTTTPSPPPTTTTTPPPTTTPSPPTTTTPSPPTITTTTPPPTTTPSPPTTTTTT 986

 Score = 52.4 bits (124), Expect = 2e-05
 Identities = 74/267 (27%), Positives = 108/267 (39%), Gaps = 25/267 (9%)
 Frame = +2

Query: 515  TRARPTTTATTPSASSRTWPAPPSRGSACCCPRAPSTRTAW---STSPTWPAGTSRA--- 676
            T + PTTT + P  ++ T P   +       P  P+T T     +T+P+ P  T+     
Sbjct: 773  TPSPPTTTPSPPPTTTTTLPPTTT-------PSPPTTTTTTPPPTTTPSPPITTTTTPLP 825

Query: 677  TSRPTP-------PPIWPMPTSPSATPTSCWTCARPAPSCSGTSMRAAWPT*PPAAAWTA 835
            T+ P+P       PP    P+ P+ TP+   T   P  + + T      P+ P     T 
Sbjct: 826  TTTPSPPISTTTTPPPTTTPSPPTTTPSPPTTTPSPPTTTTTTPPPTTTPSPPMTTPITP 885

Query: 836  WWRS*TRPSTSCCWTRSRSSSARCWPTPT---SPPSTT-IT--SRT*TAPPAAT-AAAAA 994
               + T P T+   T S  ++    P PT   SPP+TT IT  + T T PP  T +    
Sbjct: 886  PASTTTLPPTT---TPSPPTTTTTTPPPTTTPSPPTTTPITPPTSTTTLPPTTTPSPPPT 942

Query: 995  ARRRGCPSPLCCPPWARCCSLRLVLCMR--CATTASTRTCSARWCRPAWAPTPPSW---S 1159
                  P+    PP     S   +        TT S  T +     P   P+PP+    +
Sbjct: 943  TTTTPPPTTTPSPPTTTTPSPPTITTTTPPPTTTPSPPTTTTTTPPPTTTPSPPTTTPIT 1002

Query: 1160 PRSRTTTRLWTRSPARQWTGCSRTTTT 1240
            P + TTT   T +P+   T    TTTT
Sbjct: 1003 PPTSTTTLPPTTTPSPPPT----TTTT 1025

 Score = 44.3 bits (103), Expect = 0.005
 Identities = 54/199 (27%), Positives = 70/199 (35%), Gaps = 3/199 (1%)
 Frame = +2

Query: 653  WPAGTSRATSRPTPPPIWPMPTSPSATPTSCWTCARPAPSCSGTSMRAAWPT*PPAAAWT 832
            WP    +  + P+PP   P P  P  T T+      P+P  + T+      T  P    T
Sbjct: 765  WPM--DKCITTPSPPTTTPSP--PPTTTTTLPPTTTPSPPTTTTTTPPPTTTPSPPITTT 820

Query: 833  AWWRS*TRPSTSCCWTRSRSSSARCWPTPTSPPSTTITSRT*TAPPAATAAAAAARRRGC 1012
                  T PS     T +        PT T  P TT  S   T P   T           
Sbjct: 821  TTPLPTTTPSPPISTTTTPP------PTTTPSPPTTTPSPPTTTPSPPTTTTTTPPPTTT 874

Query: 1013 PSPLCCPPWARCCSLRLVLCMRCATTASTRTCSARWCRPAWAPTPPSW---SPRSRTTTR 1183
            PSP    P     S      +   TT S  T +     P   P+PP+    +P + TTT 
Sbjct: 875  PSPPMTTPITPPAS---TTTLPPTTTPSPPTTTTTTPPPTTTPSPPTTTPITPPTSTTTL 931

Query: 1184 LWTRSPARQWTGCSRTTTT 1240
              T +P+   T    TTTT
Sbjct: 932  PPTTTPSPPPT----TTTT 946



EST assemble image


clone accession position
1 MXL012h01_r BP093737 1 525
2 CL39e03_r AV395184 78 536
3 LCL034b03_r AV627934 131 416
4 LCL018f11_r AV626952 208 685
5 CL29g07_r AV394643 381 873
6 CL52d08_r AV395885 677 1162
7 LCL024e12_r AV627297 869 1284




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research