KCC000439A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000439A_C01 KCC000439A_c01
gctcccggcaagcgccacatcagcaacgcgctacgcggcacgcccttctacacctcgccc
gagaccgtgGCCACGGGCACGCTGACCAAGGCCTCAGACGTGTATTCGTTCGGCGTGATC
GCGTGGGAGGTGTACACCGGCCGCCCGCCCTTCACACACAGCCCGGAGCGGGGCTTCGTG
CGCGACGACGTCTTCCCGCGCCTTCCGCCACACGTGCCGCCAACCTTGGCCAACCTCACG
CTCGCCTGCCTCAGCGCCGACCCCGACCAGCGCCCCACGTTCGACCAGATCCTGGACCGC
ATCGTGCAGCTGCAGTCCAAGCTGGCTCAGAGCCTGCAGCAGCGCCTGTCGCGCCTGGTC
GCCAGCCACGGCGCACAGCCCGGCCTCGGACCTAGTGCGCTCGTAGCCGCGGCGAGCGCC
AGCGGCGGCCCCGGCAGCTTCGGCGCCAGCGGGGCCGGAGGCAGTGGGCTCATGGCGCCT
GCGGGCGCCATGTCTCCTGGAGGCGGCAGTGCAATTACGCCCGGCAGCGCTGCAGGCCTG
CTTGCCGGGGGCGGCCCGGTCGGCATGGGGGGCTCGGGCCAGTACACGCCGCTGTTCG


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000439A_C01 KCC000439A_c01
         (598 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

gb|AAM34041.1|AF481923_1 cyclic GMP-binding protein C [Dictyoste...    69  7e-11
dbj|BAA21906.1| serine/threonine protein kinase [Streptomyces gr...    68  9e-11
ref|NP_625829.1| putative eukaryotic-type protein kinase [Strept...    68  1e-10
dbj|BAB62588.1| P0454H12.21 [Oryza sativa (japonica cultivar-gro...    67  1e-10
dbj|BAB89014.1| P0401G10.22 [Oryza sativa (japonica cultivar-gro...    67  1e-10

>gb|AAM34041.1|AF481923_1 cyclic GMP-binding protein C [Dictyostelium discoideum]
          Length = 2631

 Score = 68.6 bits (166), Expect = 7e-11
 Identities = 35/102 (34%), Positives = 54/102 (52%), Gaps = 7/102 (6%)
 Frame = +1

Query: 43   PFYTSPETVATGTLTKASDVYSFGVIAWEVYTGRPPFTH---SPERGFVRDDVF----PR 201
            P +  PE +A    ++ SDVYSFG+I WE+YT   PF           + D++     P 
Sbjct: 1066 PLWLGPEVLAGTAYSEPSDVYSFGIILWELYTRAHPFDEFQFGQWMSKLEDEIIRGLRPT 1125

Query: 202  LPPHVPPTLANLTLACLSADPDQRPTFDQILDRIVQLQSKLA 327
            +PP  PP    L  +C + +P+ RPTF  I++ + Q++ K A
Sbjct: 1126 IPPTCPPEYVELIQSCWTHEPNSRPTFTSIVEILGQIKKKFA 1167

>dbj|BAA21906.1| serine/threonine protein kinase [Streptomyces griseus]
          Length = 555

 Score = 68.2 bits (165), Expect = 9e-11
 Identities = 54/189 (28%), Positives = 81/189 (42%), Gaps = 8/189 (4%)
 Frame = +1

Query: 37  GTPFYTSPETVATGTLTKASDVYSFGVIAWEVYTGRPPFTHSPERGFVRDDVF--PRLPP 210
           GTP Y +PE+      T A D+Y  G++ +E+ TGRPPF        +   +   PR P 
Sbjct: 183 GTPAYVAPESAEGRPQTSAVDIYGAGILLYELVTGRPPFAGGTALEVLHRHLSEEPRRPS 242

Query: 211 HVPPTLANLTLACLSADPDQRPTFDQILDRIVQLQSKLAQSLQQRLSRLVASHGAQPGLG 390
           +VP  L  +   CLS DPD+RP+               A++L + L  + A      G+G
Sbjct: 243 NVPAPLWTVIERCLSKDPDRRPS---------------AENLARGLRTVAA------GIG 281

Query: 391 PSALVAAASASGGPGSFGASGAGGSGLMAPAGA-----MSPGGGSAITPGSAAGLL-AGG 552
             A  A  +A+ G G+  A     + +    GA     + P    +  P +   +    G
Sbjct: 282 VHANSAQIAAADGVGALLAPDPAPTAVPDTPGAADPTQVLPSNAPSYDPAAPTSVFQQTG 341

Query: 553 GPVGMGGSG 579
           GP G G  G
Sbjct: 342 GPGGQGPGG 350

>ref|NP_625829.1| putative eukaryotic-type protein kinase [Streptomyces coelicolor
           A3(2)] gi|7106668|emb|CAB76070.1| putative
           eukaryotic-type protein kinase [Streptomyces coelicolor
           A3(2)]
          Length = 493

 Score = 67.8 bits (164), Expect = 1e-10
 Identities = 63/236 (26%), Positives = 90/236 (37%), Gaps = 44/236 (18%)
 Frame = +1

Query: 16  HISNALRGTPFYTSPETVATGTLTKASDVYSFGVIAWEVYTGRPPFTHSPERGFVRDDVF 195
           H+  A+ G+P + +PE V    +T A+DV+S G        G  PF H      +   V 
Sbjct: 182 HVGTAV-GSPGFLAPEQVRGAAVTPATDVFSLGATLAYASMGDSPFGHGSSEVMLYRVVH 240

Query: 196 PRLPPH-VPPTLANLTLACLSADPDQRPTFDQILDRIVQLQSKLAQSL------------ 336
                H VP  LA L  ACL+ DP++RP+  Q+  R+ ++ ++ AQ +            
Sbjct: 241 EEAQLHGVPDALAPLVRACLAKDPEERPSTLQLSLRLKEIAAREAQGMADVRPPAPRSGE 300

Query: 337 ----------------QQRLSRLVASHGAQPGLGPSALVAAASASGGPGSFGASGAGGS- 465
                           Q+R        G     G SA   +A     P   GA   GG+ 
Sbjct: 301 ADVPTGRLADTYPERAQRRPQGRPGPQGTPAPRGTSASRGSAPRGSVPSRGGAPSRGGTP 360

Query: 466 ---GLMAPAGAMSPGGGSAI-----------TPGSAAGLLAGGGPVGMGGSGQYTP 591
              G  +  G  S GGG+             T G  +    GG P   GGSG+  P
Sbjct: 361 SRGGTPSRGGTSSRGGGTGARSGSRPTPTRDTTGRNSSRNDGGRPAPRGGSGRTAP 416

>dbj|BAB62588.1| P0454H12.21 [Oryza sativa (japonica cultivar-group)]
          Length = 344

 Score = 67.4 bits (163), Expect = 1e-10
 Identities = 52/182 (28%), Positives = 79/182 (42%), Gaps = 21/182 (11%)
 Frame = +1

Query: 16  HISNALRGTPFYTSPETVATGTLTKASDVYSFGVIAWEVYTGRPPFTHSPE--------- 168
           HIS  ++GTP Y  PE   T  LT  SDVYS GV+  E+ TG  P  H            
Sbjct: 169 HISTVVKGTPGYLDPEYFLTHKLTDKSDVYSLGVVLLELLTGMKPIQHGKNIVREVNTAY 228

Query: 169 -----RGFVRDDVFPRLPPHVPPTLANLTLACLSADPDQRPTFDQILDRIVQLQSKLAQS 333
                 G + + +     P     LA+L + C   + D RP+   ++  +  ++S L + 
Sbjct: 229 QSGEIAGVIDERISSSSSPECVARLASLAVKCCKDETDARPSMADVVRELDAIRSALPEG 288

Query: 334 LQQRLSRLVASHGAQPGLGPS--ALVAAASASGGPGSFGASGAGG-----SGLMAPAGAM 492
                  L+  +G Q     S  A    +S+S     F +SG+GG     SG+  P+G +
Sbjct: 289 -----EELLPEYGDQSATSTSLTATGPLSSSSTTGALFISSGSGGHANSKSGI--PSGTV 341

Query: 493 SP 498
           +P
Sbjct: 342 AP 343

>dbj|BAB89014.1| P0401G10.22 [Oryza sativa (japonica cultivar-group)]
          Length = 942

 Score = 67.4 bits (163), Expect = 1e-10
 Identities = 49/176 (27%), Positives = 77/176 (42%), Gaps = 17/176 (9%)
 Frame = +1

Query: 1    APGKRHISNALRGTPFYTSPETVATGTLTKASDVYSFGVIAWEVYTGRPPFTH------- 159
            APG  H+S  ++GTP Y  PE   T  LT  SDVYS GV+  E+ TG  P +H       
Sbjct: 760  APG--HVSTVIKGTPGYLDPEYFLTHKLTDKSDVYSLGVVFLELLTGMQPISHGRNIVRE 817

Query: 160  ---SPERGFVRDDVFPRL---PPHVPPTLANLTLACLSADPDQRPTFDQILDRIVQLQSK 321
               + + G +   V  R+   P       A L L C   + D RP+  +++  + ++   
Sbjct: 818  VVAANQSGMILSVVDSRMGSYPAECVEKFAALALRCCRDETDARPSIVEVMRELEKIWQM 877

Query: 322  LAQSLQQRLSRLVASHGAQPGLGPSALVAAASASGGPG----SFGASGAGGSGLMA 477
               +       L  S+ A P  G   +V+++S  G       +  +S   GS L++
Sbjct: 878  TPDTGSMSSLSLEPSNTATPSSGSRMMVSSSSGVGNDDHHHYNMSSSDVSGSNLLS 933



EST assemble image


clone accession position
1 LCL067e03_r AV629849 1 174
2 CL29f03_r AV394639 70 598




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research