KCC000437A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000437A_C01 KCC000437A_c01
CAGTTCAGGTCGGAAGCAACTTGGACTCTCCACCCCGAAAAGCACCCCAAAGTCACCTCC
ACGGTCCCGGCCCTTTGCGGGCCTCGTTTCGGTCCCGGCCACAGTATAAATAGGAGGGAG
CTACACTTCACGAGGCGACGCAGCGACTGCACGTAGTGACGCCAACGCGACCAATTGCAC
ACCGGCTCCGACACCTAAACGTTGCACATTTCGCTTCTGCCAATCCAGCACGATGTCCCT
TTTGCGTGCTCCGACATCATGCAGCCGCACTGTGCAGTCACAGCAGGGACGGTCGCGGAA
GTCGCCCGTCGTGCGGGCCTATCTCGAGGAGAAGAAGGCGCCTCTCCCGCCTCGCGGGCC
CTACTCCACAGTTCCAGCTCAGACCTTTAAGAACCAGCTTGAGGCTCTGAAATCAATGTC
CGTCGTCGTCGCGGACACTGGCGAGCTGGACCTGGTCAAGAAGTACCACCCCCAGGACTG
CACAACCAACCCCAGCCTGGTCTACAAGGCGCTGTCCATGCCCGAGAACCGACACTACCT
GGAGAAGGCGCTGGCCAAGGACAAGCGGCAGCCGGAGCACGTGCACGCCGGCGTCAGCCG
CCCCTACGCCGGCGTTGCGGACCAGCTGGCCGTGGACCTGGGCGCCGAGCTGCTCAAGAT
CGTGCCGGGCCGCGTGTCGACCGAGGTGGACGCCAACCTGTCGTACTCGACGCAGGCCAG
TGTGGACAAGGCGCTGCGCATCATGGAGCTGTACGCCGCCAAGGGCTACAACCCCTCCCG
CATCTACATCAAGCTCGCCTCCACCTGGGAGGGCATCGAGGCGTGCCGCCGCCTGGAGAA
GCAGGGCATCAACTGCAACATGACGCTGCTGTTCTCGTTTGCGCAGGCCGCCGCATGCGC
AGACGCGGGTGCCACGCTCATCTCGCCGTTCGTGGGTCGCATCATGGACTGGTACAAGGC
CAAGGAGGGCCGCGACTTCGCCAGCCATGAGGACCCGGGCGTGCTGTCTGTAAAGCGCAT
CTACAACTACTACAAGGCGCACCATTACAAGACCATTGTGATGGCGGCGTCGTTCCGCAA
CGCTGGCGAGATCCGCGAGCTTGCGGGATGCGACAACATCACCATCTCGCCGCAGCTGCT
GGACGAGCTGCAGAAGTCCACAGAGCCGCTCGACCGCAAACTGACCCCCGAGAAGGCGCA
GACGGACGCGCTCAAGCTGTCCAACATGCACGAGGACCTGTTCGTCAAGCTGCACGGCGC
GGACCAGATGGCCGTGGAGAAGCTGGACCAGGGCATCAAGGGCTTCGTGGCGGACCAGAA
GAAGCTGGAGGACCTGCTGGCATCCATCGCCATGATGCAGGTCCGCGAGAATCACTGAGG
CCATCAAATCACGTCGCCCGGGGGGTGCGGGTGTCGACGATGAACGAGCCTAGCGAGTTC
TCCGGAGCCAGGCGCAATGGGAGCCCCGAGGCGCCTTCATGGTCGCCTGCCCTCCGCCGC
TCATCTGCGTGTGCGGCGGCCTCTCCGTCCTCCTCCTCCTCCTCCTCCTCCTCGCCGTGC
GTGTGGCCCAGCGACTGCGACGCTTCACGCGCATCGCTCCATTGCGCTGGGGATGGAACT
GTGATCTAGTGCGGATGTTGAGGGGCTGATGGACTTGGGCAGGCGAACGACACTGATGTA
CGTATGTACAATACCACACATTACATAGTTGTTGCACCGACATAAATAGGCGTGTGTAGC
AAATTGTGCAATGCTTACCCGAAGGGGTACAGATTCACTGGCTGACAAGCGGTGTCACTG
GAAAGGCTTGCTTTAGTCAGAACGCAGGCTGTCCGTGGTTTGGTGGTGCGCTAGGTCGGC
AGTTCGACGCGAAGGGCTCACATTGAGTCTTACACGTTGCTGACTACGCCTGCACGGCTA
ATGTTGTAAATCACAACCCGTCCGAAAAAAAAAAAAAAAAAAAACTCGCGGGGGGGCCGG
TCCCCATTCCCCAAGTGATCGTTAGAGCGCAGGGCATGTGACAAACTGG


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000437A_C01 KCC000437A_c01
         (2029 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|NP_233012.1| transaldolase B [Vibrio cholerae O1 biovar elto...   338  2e-91
ref|ZP_00067628.1| COG0176: Transaldolase [Microbulbifer degrada...   336  8e-91
ref|NP_246541.1| Tal [Pasteurella multocida] gi|17433236|sp|Q9CK...   332  2e-89
dbj|BAC97127.1| transaldolase [Vibrio vulnificus YJ016]               331  3e-89
ref|NP_762510.1| Transaldolase [Vibrio vulnificus CMCP6] gi|3330...   331  3e-89

>ref|NP_233012.1| transaldolase B [Vibrio cholerae O1 biovar eltor str. N16961]
            gi|12644556|sp|Q9KLW8|TAL_VIBCH Transaldolase
            gi|11257230|pir||B82437 transaldolase B VCA0623
            [imported] - Vibrio cholerae (strain N16961 serogroup O1)
            gi|9658036|gb|AAF96524.1| transaldolase B [Vibrio
            cholerae O1 biovar eltor str. N16961]
          Length = 316

 Score =  338 bits (868), Expect = 2e-91
 Identities = 178/318 (55%), Positives = 221/318 (68%)
 Frame = +2

Query: 392  NQLEALKSMSVVVADTGELDLVKKYHPQDCTTNPSLVYKALSMPENRHYLEKALAKDKRQ 571
            N+L  L+ ++ VVADTGE+D +KKY P+D TTNPSL+ KA  + E    +++A+A  K Q
Sbjct: 3    NKLAQLRKLTTVVADTGEIDAIKKYQPEDATTNPSLILKAAQIAEYAPLIDQAIAYAKTQ 62

Query: 572  PEHVHAGVSRPYAGVADQLAVDLGAELLKIVPGRVSTEVDANLSYSTQASVDKALRIMEL 751
                   V        D LAV++G E+LK +PGR+STEVDA LSY T+ SV KA +++++
Sbjct: 63   SNDKAQQVQ----DTCDMLAVNIGKEILKTIPGRISTEVDARLSYDTERSVAKARQLVKM 118

Query: 752  YAAKGYNPSRIYIKLASTWEGIEACRRLEKQGINCNMTLLFSFAQAAACADAGATLISPF 931
            Y   G +  RI IKLASTWEGI A   LEK+GINCN+TLLFSFAQA ACA+AG  LISPF
Sbjct: 119  YNDAGISNDRILIKLASTWEGIRAAEILEKEGINCNLTLLFSFAQARACAEAGVFLISPF 178

Query: 932  VGRIMDWYKAKEGRDFASHEDPGVLSVKRIYNYYKAHHYKTIVMAASFRNAGEIRELAGC 1111
            VGRIMDWYKAKEGRDFA+ EDPGVLSV +IYNYYK H YKT+VM ASFRN GEI ELAGC
Sbjct: 179  VGRIMDWYKAKEGRDFAASEDPGVLSVTKIYNYYKEHGYKTVVMGASFRNIGEILELAGC 238

Query: 1112 DNITISPQLLDELQKSTEPLDRKLTPEKAQTDALKLSNMHEDLFVKLHGADQMAVEKLDQ 1291
            D +TI+P LL EL+ +   L  KL   K      + + M    F+  H  D MAVEKL +
Sbjct: 239  DRLTIAPSLLAELEAAEGELVAKLVDSKG--SKARPAPMTHSEFLWEHNLDAMAVEKLAE 296

Query: 1292 GIKGFVADQKKLEDLLAS 1345
            GI+ F  DQ KLE ++A+
Sbjct: 297  GIRNFAVDQGKLEAMIAA 314

>ref|ZP_00067628.1| COG0176: Transaldolase [Microbulbifer degradans 2-40]
          Length = 314

 Score =  336 bits (862), Expect = 8e-91
 Identities = 176/321 (54%), Positives = 223/321 (68%), Gaps = 1/321 (0%)
 Frame = +2

Query: 392  NQLEALKSMSVVVADTGELDLVKKYHPQDCTTNPSLVYKALSMPENRHYLEKALAKDKRQ 571
            N+LE LK  S VVADTG+++ +K+Y P D TTNPSL++KA  +P+    LEKALA+    
Sbjct: 7    NKLEQLKQFSSVVADTGDIEAIKRYQPLDATTNPSLLFKAAQLPQYAPLLEKALAE---- 62

Query: 572  PEHVHAGVSRPYAGVADQLAVDLGAELLKIVPGRVSTEVDANLSYSTQASVDKALRIMEL 751
                    S       D+LAV +G E+LKIVPGRVSTEVDA LS+   AS+DKA R++++
Sbjct: 63   --------SSSIDDACDRLAVAIGCEILKIVPGRVSTEVDARLSFDKNASIDKAHRLIDM 114

Query: 752  YAAKGYNPSRIYIKLASTWEGIEACRRLEKQGINCNMTLLFSFAQAAACADAGATLISPF 931
            Y A G    R+ IKLASTWEGI A  +L+K+GI+CN+TLLFSF+QAAACADAG  LISPF
Sbjct: 115  YEANGIGKERVLIKLASTWEGIRAAEQLQKEGIDCNLTLLFSFSQAAACADAGVFLISPF 174

Query: 932  VGRIMDWYKAK-EGRDFASHEDPGVLSVKRIYNYYKAHHYKTIVMAASFRNAGEIRELAG 1108
            VGRI+DWYKA  + +++  HEDPGV+SV RIYNYYK H YKT+VM ASFRN GE+ ELAG
Sbjct: 175  VGRILDWYKANTDKKEYLPHEDPGVISVSRIYNYYKQHDYKTVVMGASFRNTGELEELAG 234

Query: 1109 CDNITISPQLLDELQKSTEPLDRKLTPEKAQTDALKLSNMHEDLFVKLHGADQMAVEKLD 1288
            CD +TISP LL+ L + T  L+RKL+PE +     KL   +E  +   +  D MA  KL 
Sbjct: 235  CDRLTISPDLLEALAQDTGKLERKLSPENSGEPIAKLIE-NESQYRFSNNEDAMATHKLA 293

Query: 1289 QGIKGFVADQKKLEDLLASIA 1351
            +GI+ F  DQ  L +LL S A
Sbjct: 294  EGIRNFAKDQINLINLLKSKA 314

>ref|NP_246541.1| Tal [Pasteurella multocida] gi|17433236|sp|Q9CKL0|TALA_PASMU
            Transaldolase A gi|12721999|gb|AAK03686.1| Tal
            [Pasteurella multocida]
          Length = 317

 Score =  332 bits (850), Expect = 2e-89
 Identities = 174/316 (55%), Positives = 228/316 (72%), Gaps = 1/316 (0%)
 Frame = +2

Query: 395  QLEALKSMSVVVADTGELDLVKKYHPQDCTTNPSLVYKALSMPENRHYLEKALAKDKRQP 574
            QL++L++M+VVVADTG+++ +KKY P+D TTNPSL+  A ++P+    +++A+A  K + 
Sbjct: 4    QLDSLRNMTVVVADTGDIEAIKKYQPEDATTNPSLILSASALPQYASLIDEAIAYAKSKS 63

Query: 575  EHVHAGVSRPYAGVADQLAVDLGAELLKIVPGRVSTEVDANLSYSTQASVDKALRIMELY 754
                    +      D+LAV++G E+LKIVPGR+STEVDA LSY TQA+++KA +++ LY
Sbjct: 64   NCS----KQQLIDAEDKLAVNIGLEILKIVPGRISTEVDARLSYDTQATIEKAKKLIALY 119

Query: 755  AAKGYNPSRIYIKLASTWEGIEACRRLEKQGINCNMTLLFSFAQAAACADAGATLISPFV 934
               G +  RI IK+ASTW+GI A   LEKQGINCN+TLLFS AQA ACA+AG  LISPFV
Sbjct: 120  NEAGISNDRILIKIASTWQGIRAAEELEKQGINCNLTLLFSEAQARACAEAGVYLISPFV 179

Query: 935  GRIMDWYKA-KEGRDFASHEDPGVLSVKRIYNYYKAHHYKTIVMAASFRNAGEIRELAGC 1111
            GRI+DWYKA  + +D+A  EDPGV+SV +IYNYYK H Y TIVM ASFRN GEI ELAGC
Sbjct: 180  GRILDWYKANSDKKDYAPAEDPGVISVTKIYNYYKQHGYNTIVMGASFRNVGEITELAGC 239

Query: 1112 DNITISPQLLDELQKSTEPLDRKLTPEKAQTDALKLSNMHEDLFVKLHGADQMAVEKLDQ 1291
            D +TI+P LL ELQ++  PL+RKL+    +  A K   + E  F   H +D MAVEKL  
Sbjct: 240  DRLTIAPALLKELQENNAPLERKLS-YTGEVKA-KPQPLTEAEFYWQHNSDAMAVEKLAD 297

Query: 1292 GIKGFVADQKKLEDLL 1339
            GI+ F ADQ+KLE +L
Sbjct: 298  GIRKFAADQEKLEAML 313

>dbj|BAC97127.1| transaldolase [Vibrio vulnificus YJ016]
          Length = 316

 Score =  331 bits (848), Expect = 3e-89
 Identities = 172/318 (54%), Positives = 220/318 (69%)
 Frame = +2

Query: 392  NQLEALKSMSVVVADTGELDLVKKYHPQDCTTNPSLVYKALSMPENRHYLEKALAKDKRQ 571
            N+LE L+ ++ VVADTGE+D +KKY P+D TTNPSL+ KA  + E    ++ ++   K Q
Sbjct: 3    NKLEQLRKLTTVVADTGEIDAIKKYQPEDATTNPSLILKAAQIAEYAPLIDASIEYAKTQ 62

Query: 572  PEHVHAGVSRPYAGVADQLAVDLGAELLKIVPGRVSTEVDANLSYSTQASVDKALRIMEL 751
             +      ++      D LAV++G E+LK +PGR+STEVDA LSY  + SV KA +++++
Sbjct: 63   SDDK----AQQIQDTCDMLAVNIGKEILKTIPGRISTEVDARLSYDMEGSVAKARQLVKM 118

Query: 752  YAAKGYNPSRIYIKLASTWEGIEACRRLEKQGINCNMTLLFSFAQAAACADAGATLISPF 931
            Y   G    RI IKLASTWEGI A   LEK+GINCN+TLLFSFAQA ACA+AG  LISPF
Sbjct: 119  YNDAGITNDRILIKLASTWEGIRAAEILEKEGINCNLTLLFSFAQARACAEAGVFLISPF 178

Query: 932  VGRIMDWYKAKEGRDFASHEDPGVLSVKRIYNYYKAHHYKTIVMAASFRNAGEIRELAGC 1111
            VGRIMDWYKAKEGRDF + EDPGVLSV +IYNYYK + YKT+VM ASFRN GEI ELAGC
Sbjct: 179  VGRIMDWYKAKEGRDFEAQEDPGVLSVTKIYNYYKEYGYKTVVMGASFRNIGEILELAGC 238

Query: 1112 DNITISPQLLDELQKSTEPLDRKLTPEKAQTDALKLSNMHEDLFVKLHGADQMAVEKLDQ 1291
            D +TI+P LL EL+ +   +  KL   K   +  + + M    F+  H  D MAVEKL +
Sbjct: 239  DRLTIAPALLAELEAAEGEVVEKLVDSKGAAE--RPAPMTHAEFLWEHNQDPMAVEKLAE 296

Query: 1292 GIKGFVADQKKLEDLLAS 1345
            GI+ F  DQ KLE ++A+
Sbjct: 297  GIRNFAVDQGKLEAMIAA 314

>ref|NP_762510.1| Transaldolase [Vibrio vulnificus CMCP6]
            gi|33301695|sp|Q8D6H9|TAL_VIBVU Transaldolase
            gi|27358551|gb|AAO07500.1|AE016810_3 Transaldolase
            [Vibrio vulnificus CMCP6]
          Length = 316

 Score =  331 bits (848), Expect = 3e-89
 Identities = 172/318 (54%), Positives = 220/318 (69%)
 Frame = +2

Query: 392  NQLEALKSMSVVVADTGELDLVKKYHPQDCTTNPSLVYKALSMPENRHYLEKALAKDKRQ 571
            N+LE L+ ++ VVADTGE+D +KKY P+D TTNPSL+ KA  + E    ++ ++   K Q
Sbjct: 3    NKLEQLRKLTTVVADTGEIDAIKKYQPEDATTNPSLILKAAQIAEYAPLIDASIEYAKTQ 62

Query: 572  PEHVHAGVSRPYAGVADQLAVDLGAELLKIVPGRVSTEVDANLSYSTQASVDKALRIMEL 751
             +      ++      D LAV++G E+LK +PGR+STEVDA LSY  + SV KA +++++
Sbjct: 63   SDDK----AQQIQDTCDMLAVNIGKEILKTIPGRISTEVDARLSYDMEGSVAKARQLVKM 118

Query: 752  YAAKGYNPSRIYIKLASTWEGIEACRRLEKQGINCNMTLLFSFAQAAACADAGATLISPF 931
            Y   G    RI IKLASTWEGI A   LEK+GINCN+TLLFSFAQA ACA+AG  LISPF
Sbjct: 119  YNDAGITNDRILIKLASTWEGIRAAEILEKEGINCNLTLLFSFAQARACAEAGVFLISPF 178

Query: 932  VGRIMDWYKAKEGRDFASHEDPGVLSVKRIYNYYKAHHYKTIVMAASFRNAGEIRELAGC 1111
            VGRIMDWYKAKEGRDF + EDPGVLSV +IYNYYK + YKT+VM ASFRN GEI ELAGC
Sbjct: 179  VGRIMDWYKAKEGRDFEAQEDPGVLSVTKIYNYYKEYGYKTVVMGASFRNIGEILELAGC 238

Query: 1112 DNITISPQLLDELQKSTEPLDRKLTPEKAQTDALKLSNMHEDLFVKLHGADQMAVEKLDQ 1291
            D +TI+P LL EL+ +   +  KL   K   +  + + M    F+  H  D MAVEKL +
Sbjct: 239  DRLTIAPALLAELEAAEGEVVEKLVDSKGAAE--RPAAMTHAEFLWEHNQDPMAVEKLAE 296

Query: 1292 GIKGFVADQKKLEDLLAS 1345
            GI+ F  DQ KLE ++A+
Sbjct: 297  GIRNFAVDQGKLEAMIAA 314



EST assemble image


clone accession position
1 HC016e09_r AV633083 1 584
2 MX236b10_r BP091267 23 419
3 MXL058f07_r BP096433 97 535
4 CM014c03_r AV387381 100 686
5 MX217h03_r BP090037 105 397
6 LCL024d08_r AV627286 106 303
7 CM026a02_r AV387567 106 691
8 HCL062d11_r AV643024 109 618
9 CM056c05_r AV390288 110 665
10 MX222e11_r BP090346 113 402
11 CM067b12_r AV390923 113 722
12 HCL037b03_r AV641598 113 645
13 LC097f04_r AV625768 114 524
14 CM071e07_r AV391324 114 744
15 HCL051c09_r AV642408 120 641
16 MXL097b12_r BP098672 120 422
17 CL29c04_r AV394675 128 617
18 MX055b07_r BP088241 134 372
19 MX061f09_r BP088489 134 469
20 HCL004f09_r AV639767 171 491
21 LCL007h12_r AV626368 319 855
22 CM069h05_r AV391222 370 981
23 HC016h04_r AV633110 444 931
24 HC006c02_r AV632279 608 1117
25 LC037f10_r AV621550 912 1369
26 HC005e04_r AV632224 1017 1464
27 LC020b01_r AV620286 1071 1621
28 LC037h03_r AV621564 1071 1544
29 CM086d11_r AV392516 1171 1724
30 CM074d04_r AV391528 1521 2135




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research