KCC000436A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000436A_C01 KCC000436A_c01
CGACACTCGCTCCGTTACCTTGTGGGCGCCCCAGGTGGCGACGTCCACCAGGAGCACAGC
GCCCCTACACTCACATGACGCGGCGCCCCAACATGGCCCCACTCCGCCTTCCGCTCTGGT
CTACGTACGCATTTGTCCCGCGACACTAGTCAATGGCATACGGCGCCTCAACTCCGCACC
TGCGGCCATCCTGTGTAACTAGCCCTACCGCTCCTCCTAGTCCCTTGCTCCTGCCTTGCA
GCTATTCCTACACACACCACTCCTCCTCCTCCGCCGCCGCCCAATCCTCCTCTGCCTCCT
CCTCCAGCTCCTCCTTCGTTTCCCTTGGTAGCCTGTATCATACCCTCCACAAACACACAC
TGGCAAACACACGCACGCAACACCCAACTTCCCCCTCCCGCCCCTCTATTTGCCCTCGTC
CATCTCCACGTAGTCCGGGTTCTTGGCGCACAGCACCACGCCCTCCAGCACCGGGCTCAG
CGGCAGncactcctccgt


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000436A_C01 KCC000436A_c01
         (498 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

gb|AAQ63049.1| diaphanous 1 [Homo sapiens]                             46  3e-08
sp|Q9FPQ6|GP1_CHLRE Vegetative cell wall protein gp1 precursor (...    49  4e-08
pir||S27200 proline-rich protein - mouse gi|220500|dbj|BAA01570....    49  5e-08
emb|CAB62280.1| hydroxyproline-rich glycoprotein DZ-HRGP [Volvox...    48  6e-08
dbj|BAC57890.1| pherophorin [Volvox carteri f. nagariensis]            47  8e-08

>gb|AAQ63049.1| diaphanous 1 [Homo sapiens]
          Length = 1272

 Score = 46.2 bits (108), Expect(2) = 3e-08
 Identities = 25/57 (43%), Positives = 29/57 (50%), Gaps = 6/57 (10%)
 Frame = +1

Query: 256 TTPPPPPPPNPPLPPPP------APPSFPLVACIIPSTNTHWQTHARNTQLPPPAPL 408
           TTPPPPPPP PP PP P      +PPS P    I P         + +  +PPP PL
Sbjct: 606 TTPPPPPPPPPPPPPLPGGVCISSPPSLPGGTAISPPPPL-----SGDATIPPPPPL 657

 Score = 34.3 bits (77), Expect = 0.86
 Identities = 14/27 (51%), Positives = 15/27 (54%)
 Frame = +1

Query: 244 IPTHTTPPPPPPPNPPLPPPPAPPSFP 324
           +P     PPPPPP P  P  P PP FP
Sbjct: 707 LPGEAGMPPPPPPLPGGPGIPPPPPFP 733

 Score = 32.7 bits (73), Expect(2) = 3e-08
 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 1/39 (2%)
 Frame = +3

Query: 384 PTSPSRPSICPRPSPRS-PGSWRTAPRPPAPGSAAXTPP 497
           P  P  P     PSP S PG     P PP PGSA   PP
Sbjct: 652 PPPPPLPEGVGIPSPSSLPGGTAIPPPPPLPGSARIPPP 690

 Score = 32.3 bits (72), Expect(2) = 0.008
 Identities = 17/40 (42%), Positives = 20/40 (49%), Gaps = 14/40 (35%)
 Frame = +1

Query: 238 AAIPTHTTPPPP---------PPPNPPLP-----PPPAPP 315
           +++P  T  PPP         PPP PPLP     PPP PP
Sbjct: 667 SSLPGGTAIPPPPPLPGSARIPPPPPPLPGSAGIPPPPPP 706

 Score = 32.3 bits (72), Expect = 3.3
 Identities = 17/41 (41%), Positives = 20/41 (48%)
 Frame = +3

Query: 375 TQHPTSPSRPSICPRPSPRSPGSWRTAPRPPAPGSAAXTPP 497
           T  P+ PSR  + P P P    S    P PPAPG +   PP
Sbjct: 571 TVPPSVPSRAPVPPAP-PLPGDSGTIIPPPPAPGDSTTPPP 610

 Score = 31.6 bits (70), Expect = 5.6
 Identities = 16/34 (47%), Positives = 17/34 (49%), Gaps = 7/34 (20%)
 Frame = +1

Query: 244 IPTHTTPPPPPPPNP-----PLPPPPAP--PSFP 324
           +P     PPPPPP P     P PPPP P  P  P
Sbjct: 694 LPGSAGIPPPPPPLPGEAGMPPPPPPLPGGPGIP 727

 Score = 31.6 bits (70), Expect = 5.6
 Identities = 16/32 (50%), Positives = 16/32 (50%), Gaps = 14/32 (43%)
 Frame = +1

Query: 262 PPPPPP---------PNPPLP-----PPPAPP 315
           PPPPPP         P PPLP     PPP PP
Sbjct: 688 PPPPPPLPGSAGIPPPPPPLPGEAGMPPPPPP 719

 Score = 29.6 bits (65), Expect(2) = 0.014
 Identities = 13/38 (34%), Positives = 15/38 (39%)
 Frame = +3

Query: 384 PTSPSRPSICPRPSPRSPGSWRTAPRPPAPGSAAXTPP 497
           P  P    +C    P  PG    +P PP  G A   PP
Sbjct: 617 PPPPLPGGVCISSPPSLPGGTAISPPPPLSGDATIPPP 654

 Score = 29.6 bits (65), Expect(2) = 0.014
 Identities = 14/38 (36%), Positives = 18/38 (46%)
 Frame = +1

Query: 199 LALPLLLVPCSCLAAIPTHTTPPPPPPPNPPLPPPPAP 312
           L+   + VP S  +  P    PP P      +PPPPAP
Sbjct: 565 LSAAAITVPPSVPSRAPVPPAPPLPGDSGTIIPPPPAP 602

 Score = 27.7 bits (60), Expect(2) = 0.008
 Identities = 12/28 (42%), Positives = 12/28 (42%)
 Frame = +3

Query: 414 PRPSPRSPGSWRTAPRPPAPGSAAXTPP 497
           P P P  PG     P PP PG     PP
Sbjct: 714 PPPPPPLPGGPGIPPPPPFPGGPGIPPP 741

>sp|Q9FPQ6|GP1_CHLRE Vegetative cell wall protein gp1 precursor (Hydroxyproline-rich
           glycoprotein 1) gi|12018147|gb|AAG45420.1|AF309494_1
           vegetative cell wall protein gp1 [Chlamydomonas
           reinhardtii]
          Length = 555

 Score = 48.5 bits (114), Expect(2) = 4e-08
 Identities = 25/55 (45%), Positives = 31/55 (55%)
 Frame = +1

Query: 241 AIPTHTTPPPPPPPNPPLPPPPAPPSFPLVACIIPSTNTHWQTHARNTQLPPPAP 405
           A P+   P PPPPP+PP PPPP PP FP    + PS  +   + A  T   PP+P
Sbjct: 255 APPSPKPPAPPPPPSPPPPPPPRPP-FPANTPMPPSPPSPPPSPAPPTPPTPPSP 308

 Score = 42.4 bits (98), Expect(2) = 2e-05
 Identities = 23/53 (43%), Positives = 24/53 (44%)
 Frame = +1

Query: 247 PTHTTPPPPPPPNPPLPPPPAPPSFPLVACIIPSTNTHWQTHARNTQLPPPAP 405
           P    PP PP P PP PP PAPPS P  A   PS          +   P PAP
Sbjct: 204 PPSPAPPVPPSPAPPSPPSPAPPSPPSPAPPSPSPPAPPSPVPPSPAPPSPAP 256

 Score = 41.2 bits (95), Expect(2) = 5e-06
 Identities = 15/24 (62%), Positives = 18/24 (74%)
 Frame = +1

Query: 247 PTHTTPPPPPPPNPPLPPPPAPPS 318
           P   +PP PP P+PP+PP PAPPS
Sbjct: 152 PPSPSPPVPPSPSPPVPPSPAPPS 175

 Score = 40.8 bits (94), Expect(2) = 8e-07
 Identities = 17/32 (53%), Positives = 18/32 (56%)
 Frame = +1

Query: 223 PCSCLAAIPTHTTPPPPPPPNPPLPPPPAPPS 318
           P S    +P    PP PP P PP PP PAPPS
Sbjct: 204 PPSPAPPVPPSPAPPSPPSPAPPSPPSPAPPS 235

 Score = 40.4 bits (93), Expect(2) = 1e-04
 Identities = 18/33 (54%), Positives = 18/33 (54%)
 Frame = +1

Query: 220 VPCSCLAAIPTHTTPPPPPPPNPPLPPPPAPPS 318
           VP S     P    PP PP P PP P PPAPPS
Sbjct: 211 VPPSPAPPSPPSPAPPSPPSPAPPSPSPPAPPS 243

 Score = 40.4 bits (93), Expect(2) = 4e-06
 Identities = 17/33 (51%), Positives = 19/33 (57%)
 Frame = +1

Query: 220 VPCSCLAAIPTHTTPPPPPPPNPPLPPPPAPPS 318
           VP S     P    PP P PP+PP P PP+PPS
Sbjct: 198 VPPSPAPPSPAPPVPPSPAPPSPPSPAPPSPPS 230

 Score = 39.3 bits (90), Expect(2) = 2e-05
 Identities = 18/35 (51%), Positives = 21/35 (59%), Gaps = 2/35 (5%)
 Frame = +1

Query: 220 VPCSCLAAIPTHTTPPPPPPPNP--PLPPPPAPPS 318
           VP S    +P    PP P PP+P  P+PP PAPPS
Sbjct: 159 VPPSPSPPVPPSPAPPSPTPPSPSPPVPPSPAPPS 193

 Score = 39.3 bits (90), Expect = 0.027
 Identities = 16/32 (50%), Positives = 18/32 (56%)
 Frame = +1

Query: 223 PCSCLAAIPTHTTPPPPPPPNPPLPPPPAPPS 318
           P S    +P    PP P PP PP P PP+PPS
Sbjct: 191 PPSPAPPVPPSPAPPSPAPPVPPSPAPPSPPS 222

 Score = 38.9 bits (89), Expect(2) = 2e-05
 Identities = 16/32 (50%), Positives = 19/32 (59%)
 Frame = +1

Query: 223 PCSCLAAIPTHTTPPPPPPPNPPLPPPPAPPS 318
           P S  +  P   +PP PP P+PP P PP PPS
Sbjct: 118 PPSPPSPAPPSPSPPAPPSPSPPSPAPPLPPS 149

 Score = 38.9 bits (89), Expect(2) = 4e-05
 Identities = 15/24 (62%), Positives = 15/24 (62%)
 Frame = +1

Query: 247 PTHTTPPPPPPPNPPLPPPPAPPS 318
           P    PP PP P PP P PPAPPS
Sbjct: 113 PPSPAPPSPPSPAPPSPSPPAPPS 136

 Score = 38.9 bits (89), Expect = 0.035
 Identities = 19/37 (51%), Positives = 21/37 (56%), Gaps = 2/37 (5%)
 Frame = +1

Query: 220 VPCSCLAAIPTHTTPPPPPPPNP--PLPPPPAPPSFP 324
           VP S     P    PP P PP+P  P+PP PAPPS P
Sbjct: 185 VPPSPAPPSPAPPVPPSPAPPSPAPPVPPSPAPPSPP 221

 Score = 38.5 bits (88), Expect(2) = 7e-05
 Identities = 16/32 (50%), Positives = 17/32 (53%)
 Frame = +1

Query: 223 PCSCLAAIPTHTTPPPPPPPNPPLPPPPAPPS 318
           P S    +P    PP P PP PP P PP PPS
Sbjct: 139 PPSPAPPLPPSPAPPSPSPPVPPSPSPPVPPS 170

 Score = 38.5 bits (88), Expect(2) = 3e-04
 Identities = 23/56 (41%), Positives = 28/56 (49%), Gaps = 3/56 (5%)
 Frame = +1

Query: 247 PTHTTPPPPP-PPNPPLPPPPAPPS--FPLVACIIPSTNTHWQTHARNTQLPPPAP 405
           P+  +PPP P PP PP PP P+PPS   P  A + PS              PPP+P
Sbjct: 288 PSPPSPPPSPAPPTPPTPPSPSPPSPVPPSPAPVPPS-----PAPPSPAPSPPPSP 338

 Score = 37.7 bits (86), Expect(2) = 2e-04
 Identities = 16/26 (61%), Positives = 18/26 (68%), Gaps = 2/26 (7%)
 Frame = +1

Query: 247 PTHTTPPPPPPPNP--PLPPPPAPPS 318
           P+   PP P PP+P  PLPP PAPPS
Sbjct: 129 PSPPAPPSPSPPSPAPPLPPSPAPPS 154

 Score = 37.7 bits (86), Expect = 0.078
 Identities = 19/40 (47%), Positives = 22/40 (54%), Gaps = 7/40 (17%)
 Frame = +1

Query: 220 VPCSCLAAIPTHTTPPPPPPPN-------PPLPPPPAPPS 318
           VP S     PT  +P PP PP+       PP+PP PAPPS
Sbjct: 167 VPPSPAPPSPTPPSPSPPVPPSPAPPSPAPPVPPSPAPPS 206

 Score = 37.0 bits (84), Expect(2) = 5e-05
 Identities = 21/61 (34%), Positives = 26/61 (42%)
 Frame = +1

Query: 223 PCSCLAAIPTHTTPPPPPPPNPPLPPPPAPPSFPLVACIIPSTNTHWQTHARNTQLPPPA 402
           P S +   P   +P PP P  P  PPPP+PP  P      P+          NT +PP  
Sbjct: 241 PPSPVPPSPAPPSPAPPSPKPPAPPPPPSPPPPPPPRPPFPA----------NTPMPPSP 290

Query: 403 P 405
           P
Sbjct: 291 P 291

 Score = 37.0 bits (84), Expect(2) = 0.001
 Identities = 23/65 (35%), Positives = 26/65 (39%), Gaps = 10/65 (15%)
 Frame = +1

Query: 241 AIPTHTTPPPPPPPNPPLP---------PPPAPPSFPLVACIIPSTNTHWQTHARNTQLP 393
           A P   +PPPPPPP PP P         P P P   P      PS +           +P
Sbjct: 263 APPPPPSPPPPPPPRPPFPANTPMPPSPPSPPPSPAPPTPPTPPSPSPPSPVPPSPAPVP 322

Query: 394 P-PAP 405
           P PAP
Sbjct: 323 PSPAP 327

 Score = 37.0 bits (84), Expect(2) = 4e-04
 Identities = 19/38 (50%), Positives = 20/38 (52%), Gaps = 4/38 (10%)
 Frame = +1

Query: 247 PTHTTPPPPPPPNP----PLPPPPAPPSFPLVACIIPS 348
           P    PP P PP+P    P PP PAPPS P  A   PS
Sbjct: 93  PPSPAPPSPAPPSPAPPSPAPPSPAPPSPPSPAPPSPS 130

 Score = 36.6 bits (83), Expect = 0.17
 Identities = 23/66 (34%), Positives = 27/66 (40%), Gaps = 11/66 (16%)
 Frame = +1

Query: 241 AIPTHTTPPPPPPPNP-----------PLPPPPAPPSFPLVACIIPSTNTHWQTHARNTQ 387
           A PT  TPP P PP+P           P PP PAP   P  A   PS +         + 
Sbjct: 298 APPTPPTPPSPSPPSPVPPSPAPVPPSPAPPSPAPSPPPSPAPPTPSPSPSPSPSPSPSP 357

Query: 388 LPPPAP 405
            P P+P
Sbjct: 358 SPSPSP 363

 Score = 36.6 bits (83), Expect = 0.17
 Identities = 18/47 (38%), Positives = 24/47 (50%)
 Frame = +1

Query: 265 PPPPPPNPPLPPPPAPPSFPLVACIIPSTNTHWQTHARNTQLPPPAP 405
           P PP P+PP+PP P+PP  P  A   P+  +       +   P PAP
Sbjct: 150 PAPPSPSPPVPPSPSPPVPPSPAPPSPTPPSPSPPVPPSPAPPSPAP 196

 Score = 36.2 bits (82), Expect = 0.23
 Identities = 16/36 (44%), Positives = 19/36 (52%)
 Frame = +1

Query: 205 LPLLLVPCSCLAAIPTHTTPPPPPPPNPPLPPPPAP 312
           LP    P S    +P   +PP PP P PP P PP+P
Sbjct: 146 LPPSPAPPSPSPPVPPSPSPPVPPSPAPPSPTPPSP 181

 Score = 35.8 bits (81), Expect(2) = 0.002
 Identities = 15/32 (46%), Positives = 17/32 (52%)
 Frame = +1

Query: 223 PCSCLAAIPTHTTPPPPPPPNPPLPPPPAPPS 318
           P S  +  P     P PP P+PP PP P PPS
Sbjct: 217 PPSPPSPAPPSPPSPAPPSPSPPAPPSPVPPS 248

 Score = 35.8 bits (81), Expect(2) = 1e-04
 Identities = 21/57 (36%), Positives = 25/57 (43%), Gaps = 4/57 (7%)
 Frame = +1

Query: 247 PTHTTPPPPPPPNP----PLPPPPAPPSFPLVACIIPSTNTHWQTHARNTQLPPPAP 405
           P    PP P PP+P    P PP PAPPS P  A   P+  +            PP+P
Sbjct: 50  PPSPAPPSPAPPSPAPPSPGPPSPAPPSPPSPAPPSPAPPSPAPPSPAPPSPAPPSP 106

 Score = 35.8 bits (81), Expect = 0.30
 Identities = 17/38 (44%), Positives = 21/38 (54%)
 Frame = +3

Query: 384 PTSPSRPSICPRPSPRSPGSWRTAPRPPAPGSAAXTPP 497
           P SP+ PS  P PSP  P     +P PP+PG  +  PP
Sbjct: 40  PPSPAPPSPAP-PSPAPPSPAPPSPAPPSPGPPSPAPP 76

 Score = 35.0 bits (79), Expect(2) = 3e-04
 Identities = 17/36 (47%), Positives = 19/36 (52%), Gaps = 4/36 (11%)
 Frame = +1

Query: 223 PCSCLAAIPTHTTPPPPPPPNP----PLPPPPAPPS 318
           P S  +  P    PP P PP+P    P PP PAPPS
Sbjct: 75  PPSPPSPAPPSPAPPSPAPPSPAPPSPAPPSPAPPS 110

 Score = 35.0 bits (79), Expect(2) = 0.003
 Identities = 19/54 (35%), Positives = 23/54 (42%), Gaps = 1/54 (1%)
 Frame = +1

Query: 247 PTHTTPPPPPPPNPPLPPPPAP-PSFPLVACIIPSTNTHWQTHARNTQLPPPAP 405
           P    PP P PP+PP P PP+P P  P      P +         +   P PAP
Sbjct: 65  PPSPGPPSPAPPSPPSPAPPSPAPPSPAPPSPAPPSPAPPSPAPPSPAPPSPAP 118

 Score = 35.0 bits (79), Expect(2) = 7e-05
 Identities = 16/27 (59%), Positives = 17/27 (62%), Gaps = 1/27 (3%)
 Frame = +1

Query: 241 AIPTHTTPPP-PPPPNPPLPPPPAPPS 318
           A P+   P P PP P PP PP PAPPS
Sbjct: 59  APPSPAPPSPGPPSPAPPSPPSPAPPS 85

 Score = 34.7 bits (78), Expect(2) = 5e-05
 Identities = 15/27 (55%), Positives = 17/27 (62%), Gaps = 1/27 (3%)
 Frame = +1

Query: 241 AIPTHTTP-PPPPPPNPPLPPPPAPPS 318
           A P+   P P PP P PP P PP+PPS
Sbjct: 54  APPSPAPPSPAPPSPGPPSPAPPSPPS 80

 Score = 34.7 bits (78), Expect(2) = 0.003
 Identities = 14/26 (53%), Positives = 17/26 (64%), Gaps = 2/26 (7%)
 Frame = +1

Query: 247 PTHTTPPPP--PPPNPPLPPPPAPPS 318
           P   +PP P  P P+PP PP P+PPS
Sbjct: 116 PAPPSPPSPAPPSPSPPAPPSPSPPS 141

 Score = 34.7 bits (78), Expect(2) = 1e-04
 Identities = 15/28 (53%), Positives = 16/28 (56%), Gaps = 4/28 (14%)
 Frame = +1

Query: 247 PTHTTPPPPPPPNP----PLPPPPAPPS 318
           P    PP P PP+P    P PP PAPPS
Sbjct: 40  PPSPAPPSPAPPSPAPPSPAPPSPAPPS 67

 Score = 34.7 bits (78), Expect = 0.66
 Identities = 14/30 (46%), Positives = 16/30 (52%)
 Frame = +1

Query: 223 PCSCLAAIPTHTTPPPPPPPNPPLPPPPAP 312
           P S    +P    PP P PP PP P PP+P
Sbjct: 178 PPSPSPPVPPSPAPPSPAPPVPPSPAPPSP 207

 Score = 34.3 bits (77), Expect = 0.86
 Identities = 18/57 (31%), Positives = 23/57 (39%)
 Frame = +1

Query: 238 AAIPTHTTPPPPPPPNPPLPPPPAPPSFPLVACIIPSTNTHWQTHARNTQLPPPAPL 408
           A +P    PP P P  PP P PP P   P      PS +         +  P P+P+
Sbjct: 319 APVPPSPAPPSPAPSPPPSPAPPTPSPSP-----SPSPSPSPSPSPSPSPSPSPSPI 370

 Score = 34.3 bits (77), Expect(2) = 0.007
 Identities = 14/28 (50%), Positives = 17/28 (60%), Gaps = 2/28 (7%)
 Frame = +1

Query: 247 PTHTTPPPPPPPNPP--LPPPPAPPSFP 324
           P    PP P PP+PP   PP P+PP+ P
Sbjct: 108 PPSPAPPSPAPPSPPSPAPPSPSPPAPP 135

 Score = 33.9 bits (76), Expect = 1.1
 Identities = 22/61 (36%), Positives = 29/61 (47%), Gaps = 8/61 (13%)
 Frame = +1

Query: 247 PTHTTPPPPPPPNPPLPPPPAP-------PSFPLVACIIPSTNTHWQTHARNTQLPP-PA 402
           P   +PP P PP PP P PP+P       PS P+     P + T     + +  +PP PA
Sbjct: 134 PPSPSPPSPAPPLPPSPAPPSPSPPVPPSPSPPVPPSPAPPSPT---PPSPSPPVPPSPA 190

Query: 403 P 405
           P
Sbjct: 191 P 191

 Score = 33.9 bits (76), Expect = 1.1
 Identities = 18/36 (50%), Positives = 18/36 (50%), Gaps = 2/36 (5%)
 Frame = +1

Query: 247 PTHTTPPPPPPPNPPLP--PPPAPPSFPLVACIIPS 348
           P    PP P PP PP P  P PAPP  P  A   PS
Sbjct: 121 PPSPAPPSPSPPAPPSPSPPSPAPPLPPSPAPPSPS 156

 Score = 33.5 bits (75), Expect(2) = 0.051
 Identities = 20/53 (37%), Positives = 24/53 (44%), Gaps = 1/53 (1%)
 Frame = +1

Query: 250 THTTPPPPPPPNPPLPP-PPAPPSFPLVACIIPSTNTHWQTHARNTQLPPPAP 405
           T   P PP PP  P PP PP PPS    + + PS      + A  +  P P P
Sbjct: 284 TPMPPSPPSPPPSPAPPTPPTPPSPSPPSPVPPSPAPVPPSPAPPSPAPSPPP 336

 Score = 33.1 bits (74), Expect(2) = 5e-05
 Identities = 16/38 (42%), Positives = 19/38 (49%)
 Frame = +3

Query: 384 PTSPSRPSICPRPSPRSPGSWRTAPRPPAPGSAAXTPP 497
           P  PS PS  P PSP  P     +P PP+P   +  PP
Sbjct: 73  PAPPSPPSPAP-PSPAPPSPAPPSPAPPSPAPPSPAPP 109

 Score = 33.1 bits (74), Expect(2) = 8e-07
 Identities = 16/38 (42%), Positives = 20/38 (52%)
 Frame = +3

Query: 384 PTSPSRPSICPRPSPRSPGSWRTAPRPPAPGSAAXTPP 497
           P+ P+ PS  P PSP  P     +P+PPAP      PP
Sbjct: 236 PSPPAPPSPVP-PSPAPPSPAPPSPKPPAPPPPPSPPP 272

 Score = 32.7 bits (73), Expect = 2.5
 Identities = 15/27 (55%), Positives = 17/27 (62%), Gaps = 1/27 (3%)
 Frame = +1

Query: 241 AIPTHTTP-PPPPPPNPPLPPPPAPPS 318
           A P+  +P PP P P  P PP PAPPS
Sbjct: 74  APPSPPSPAPPSPAPPSPAPPSPAPPS 100

 Score = 32.7 bits (73), Expect(2) = 0.005
 Identities = 17/38 (44%), Positives = 20/38 (51%)
 Frame = +3

Query: 384 PTSPSRPSICPRPSPRSPGSWRTAPRPPAPGSAAXTPP 497
           P SP+ PS  P PSP  P     +P PP+P S A   P
Sbjct: 50  PPSPAPPSPAP-PSPAPPSPGPPSPAPPSPPSPAPPSP 86

 Score = 32.3 bits (72), Expect(2) = 7e-05
 Identities = 17/38 (44%), Positives = 20/38 (51%)
 Frame = +3

Query: 384 PTSPSRPSICPRPSPRSPGSWRTAPRPPAPGSAAXTPP 497
           P SP+ PS  P PSP  P     +P PP+P S A   P
Sbjct: 93  PPSPAPPSPAP-PSPAPPSPAPPSPAPPSPPSPAPPSP 129

 Score = 32.0 bits (71), Expect(2) = 1e-04
 Identities = 16/40 (40%), Positives = 19/40 (47%), Gaps = 2/40 (5%)
 Frame = +3

Query: 384 PTSPSRPSICPR--PSPRSPGSWRTAPRPPAPGSAAXTPP 497
           P SP  PS  P   PSP  P     +P PP+P   +  PP
Sbjct: 65  PPSPGPPSPAPPSPPSPAPPSPAPPSPAPPSPAPPSPAPP 104

 Score = 31.6 bits (70), Expect(2) = 0.001
 Identities = 15/27 (55%), Positives = 16/27 (58%), Gaps = 1/27 (3%)
 Frame = +1

Query: 241 AIPTHTTP-PPPPPPNPPLPPPPAPPS 318
           A P+   P P PP P  P PP PAPPS
Sbjct: 64  APPSPGPPSPAPPSPPSPAPPSPAPPS 90

 Score = 31.2 bits (69), Expect(2) = 4e-06
 Identities = 17/40 (42%), Positives = 20/40 (49%), Gaps = 2/40 (5%)
 Frame = +3

Query: 384 PTSPSRPSICPR--PSPRSPGSWRTAPRPPAPGSAAXTPP 497
           P SP+ PS  P   PSP  P     +P PP+P   A  PP
Sbjct: 228 PPSPAPPSPSPPAPPSPVPPSPAPPSPAPPSPKPPAPPPP 267

 Score = 31.2 bits (69), Expect = 7.3
 Identities = 18/39 (46%), Positives = 20/39 (51%), Gaps = 1/39 (2%)
 Frame = +3

Query: 384 PTSPSRPSICP-RPSPRSPGSWRTAPRPPAPGSAAXTPP 497
           P SP+ PS  P  P+P SP     AP  PAP S A   P
Sbjct: 78  PPSPAPPSPAPPSPAPPSPAPPSPAPPSPAPPSPAPPSP 116

 Score = 31.2 bits (69), Expect(2) = 0.001
 Identities = 18/39 (46%), Positives = 20/39 (51%), Gaps = 1/39 (2%)
 Frame = +3

Query: 384 PTSPSRPSICP-RPSPRSPGSWRTAPRPPAPGSAAXTPP 497
           P SP+ PS  P  P+P SP     AP  PAP S A   P
Sbjct: 83  PPSPAPPSPAPPSPAPPSPAPPSPAPPSPAPPSPAPPSP 121

 Score = 31.2 bits (69), Expect = 7.3
 Identities = 16/53 (30%), Positives = 21/53 (39%)
 Frame = +1

Query: 247 PTHTTPPPPPPPNPPLPPPPAPPSFPLVACIIPSTNTHWQTHARNTQLPPPAP 405
           P   +P P PP   P  P P+PP  P      PS +         +  P P+P
Sbjct: 313 PVPPSPAPVPPSPAPPSPAPSPPPSPAPPTPSPSPSPSPSPSPSPSPSPSPSP 365

 Score = 30.8 bits (68), Expect = 9.5
 Identities = 15/33 (45%), Positives = 17/33 (51%), Gaps = 1/33 (3%)
 Frame = +1

Query: 223 PCSCLAAIPTHTTPPPPPPPNPPLPPP-PAPPS 318
           P S +   P    P P PP   P PPP PAPP+
Sbjct: 310 PPSPVPPSPAPVPPSPAPPSPAPSPPPSPAPPT 342

 Score = 30.8 bits (68), Expect(2) = 5e-05
 Identities = 17/38 (44%), Positives = 20/38 (51%), Gaps = 2/38 (5%)
 Frame = +3

Query: 390 SPSRPSICPRPSPRSPGSWRTAPRPPAPG--SAAXTPP 497
           +P  P   P PSP SP     AP PP+P   S A +PP
Sbjct: 298 APPTPPTPPSPSPPSPVPPSPAPVPPSPAPPSPAPSPP 335

 Score = 30.8 bits (68), Expect = 9.5
 Identities = 14/35 (40%), Positives = 16/35 (45%)
 Frame = +1

Query: 220 VPCSCLAAIPTHTTPPPPPPPNPPLPPPPAPPSFP 324
           VP S     P  + PP P PP P   P P+P   P
Sbjct: 321 VPPSPAPPSPAPSPPPSPAPPTPSPSPSPSPSPSP 355

 Score = 30.8 bits (68), Expect(2) = 1e-04
 Identities = 18/38 (47%), Positives = 21/38 (54%)
 Frame = +3

Query: 384 PTSPSRPSICPRPSPRSPGSWRTAPRPPAPGSAAXTPP 497
           P SP+ PS  P PSP SP     +P PPAP S +   P
Sbjct: 108 PPSPAPPSPAP-PSPPSPAP--PSPSPPAPPSPSPPSP 142

 Score = 30.0 bits (66), Expect(2) = 5e-06
 Identities = 18/38 (47%), Positives = 19/38 (49%)
 Frame = +3

Query: 384 PTSPSRPSICPRPSPRSPGSWRTAPRPPAPGSAAXTPP 497
           P  PS PS  P PSP SP     +P PPAP S     P
Sbjct: 215 PAPPSPPSPAP-PSPPSPAP--PSPSPPAPPSPVPPSP 249

 Score = 30.0 bits (66), Expect(2) = 3e-04
 Identities = 17/39 (43%), Positives = 22/39 (55%), Gaps = 1/39 (2%)
 Frame = +3

Query: 384 PTSPSRPSICPRPSPRSPGSWRTA-PRPPAPGSAAXTPP 497
           P SP+ PS  P P+P SP     A P PP+P   + +PP
Sbjct: 121 PPSPAPPSPSP-PAPPSPSPPSPAPPLPPSPAPPSPSPP 158

 Score = 30.0 bits (66), Expect(2) = 4e-08
 Identities = 16/38 (42%), Positives = 17/38 (44%)
 Frame = +3

Query: 384 PTSPSRPSICPRPSPRSPGSWRTAPRPPAPGSAAXTPP 497
           PT P+ PS  P PSP  P      P P  P  A   PP
Sbjct: 300 PTPPTPPSPSP-PSPVPPSPAPVPPSPAPPSPAPSPPP 336

 Score = 30.0 bits (66), Expect(2) = 2e-05
 Identities = 17/38 (44%), Positives = 21/38 (54%)
 Frame = +3

Query: 384 PTSPSRPSICPRPSPRSPGSWRTAPRPPAPGSAAXTPP 497
           P SP+ PS  P P P SP    + P PP+P   + TPP
Sbjct: 147 PPSPAPPSPSP-PVPPSP----SPPVPPSPAPPSPTPP 179

 Score = 29.6 bits (65), Expect(2) = 2e-05
 Identities = 17/38 (44%), Positives = 21/38 (54%)
 Frame = +3

Query: 384 PTSPSRPSICPRPSPRSPGSWRTAPRPPAPGSAAXTPP 497
           P SP+ P + P P+P SP S    P PP+P S A   P
Sbjct: 204 PPSPA-PPVPPSPAPPSPPS----PAPPSPPSPAPPSP 236

 Score = 29.3 bits (64), Expect(2) = 4e-05
 Identities = 17/38 (44%), Positives = 20/38 (51%)
 Frame = +3

Query: 384 PTSPSRPSICPRPSPRSPGSWRTAPRPPAPGSAAXTPP 497
           P SPS P + P P+P SP     +P PP P S A   P
Sbjct: 160 PPSPS-PPVPPSPAPPSPTP--PSPSPPVPPSPAPPSP 194

 Score = 28.9 bits (63), Expect(2) = 7e-05
 Identities = 16/42 (38%), Positives = 21/42 (49%), Gaps = 4/42 (9%)
 Frame = +3

Query: 384 PTSPSRPS----ICPRPSPRSPGSWRTAPRPPAPGSAAXTPP 497
           P SP+ PS    + P P+P SP      P PP+P   +  PP
Sbjct: 173 PPSPTPPSPSPPVPPSPAPPSP----APPVPPSPAPPSPAPP 210

 Score = 28.1 bits (61), Expect(2) = 2e-04
 Identities = 17/38 (44%), Positives = 19/38 (49%)
 Frame = +3

Query: 384 PTSPSRPSICPRPSPRSPGSWRTAPRPPAPGSAAXTPP 497
           P SP+ PS  P P P SP     +P PP P S A   P
Sbjct: 186 PPSPAPPSPAP-PVPPSPAP--PSPAPPVPPSPAPPSP 220

 Score = 28.1 bits (61), Expect(2) = 0.005
 Identities = 17/45 (37%), Positives = 23/45 (50%), Gaps = 6/45 (13%)
 Frame = +1

Query: 202 ALPLLLVPCSCLAAIPTHTTPP-----PPPPPNP-PLPPPPAPPS 318
           A+ +L+V  + +A+      P      PP P  P P PP PAPPS
Sbjct: 13  AVNVLMVVLAFVASANAQCVPGGIFNCPPSPAPPSPAPPSPAPPS 57

 Score = 27.7 bits (60), Expect(2) = 4e-04
 Identities = 17/38 (44%), Positives = 19/38 (49%)
 Frame = +3

Query: 384 PTSPSRPSICPRPSPRSPGSWRTAPRPPAPGSAAXTPP 497
           P SPS PS  P P P SP     +P PP P S +   P
Sbjct: 134 PPSPSPPSPAP-PLPPSPAP--PSPSPPVPPSPSPPVP 168

 Score = 26.9 bits (58), Expect(2) = 2e-05
 Identities = 13/38 (34%), Positives = 17/38 (44%)
 Frame = +3

Query: 384 PTSPSRPSICPRPSPRSPGSWRTAPRPPAPGSAAXTPP 497
           P+ P  P+    P+P SP      P  PAP   +  PP
Sbjct: 291 PSPPPSPAPPTPPTPPSPSPPSPVPPSPAPVPPSPAPP 328

 Score = 26.9 bits (58), Expect(2) = 0.003
 Identities = 16/38 (42%), Positives = 17/38 (44%)
 Frame = +3

Query: 384 PTSPSRPSICPRPSPRSPGSWRTAPRPPAPGSAAXTPP 497
           P+ P  PS  P PSP  P      P  PAP S A   P
Sbjct: 163 PSPPVPPSPAP-PSPTPPSPSPPVPPSPAPPSPAPPVP 199

 Score = 26.6 bits (57), Expect(2) = 0.003
 Identities = 16/39 (41%), Positives = 19/39 (48%), Gaps = 1/39 (2%)
 Frame = +3

Query: 384 PTSPSRPSICPRPSPRSPGS-WRTAPRPPAPGSAAXTPP 497
           P SPS P+  P PSP SP      +P PP+P       P
Sbjct: 126 PPSPSPPAP-PSPSPPSPAPPLPPSPAPPSPSPPVPPSP 163

 Score = 26.6 bits (57), Expect(2) = 3e-04
 Identities = 14/39 (35%), Positives = 19/39 (47%), Gaps = 1/39 (2%)
 Frame = +3

Query: 384 PTSPSRPSICPRPSPRSPGSWRTAPRP-PAPGSAAXTPP 497
           P SP+ P+  P PSP    S   +P P P+P  +    P
Sbjct: 335 PPSPAPPTPSPSPSPSPSPSPSPSPSPSPSPSPSPIPSP 373

 Score = 26.2 bits (56), Expect(2) = 0.007
 Identities = 17/38 (44%), Positives = 19/38 (49%)
 Frame = +3

Query: 384 PTSPSRPSICPRPSPRSPGSWRTAPRPPAPGSAAXTPP 497
           P SPS P + P PSP  P S   AP  P P S +   P
Sbjct: 152 PPSPS-PPVPPSPSPPVPPS--PAPPSPTPPSPSPPVP 186

 Score = 26.2 bits (56), Expect(2) = 0.002
 Identities = 14/41 (34%), Positives = 21/41 (51%), Gaps = 4/41 (9%)
 Frame = +3

Query: 384 PTSPSRPSICPRPSPRSPGSWRT----APRPPAPGSAAXTP 494
           P  PS PS  P P+P +P +  +    +P PP+P     +P
Sbjct: 285 PMPPSPPSPPPSPAPPTPPTPPSPSPPSPVPPSPAPVPPSP 325

 Score = 26.2 bits (56), Expect(2) = 1e-04
 Identities = 15/39 (38%), Positives = 17/39 (43%), Gaps = 1/39 (2%)
 Frame = +3

Query: 384 PTSPSRPSICPRP-SPRSPGSWRTAPRPPAPGSAAXTPP 497
           P  P  P+  P P SP SP      P PP P S +   P
Sbjct: 275 PPRPPFPANTPMPPSPPSPPPSPAPPTPPTPPSPSPPSP 313

 Score = 26.2 bits (56), Expect(2) = 0.001
 Identities = 13/38 (34%), Positives = 16/38 (41%)
 Frame = +3

Query: 384 PTSPSRPSICPRPSPRSPGSWRTAPRPPAPGSAAXTPP 497
           P SP+ PS  P P P        +P PP P  +    P
Sbjct: 322 PPSPAPPSPAPSPPP--------SPAPPTPSPSPSPSP 351

 Score = 23.9 bits (50), Expect(2) = 0.051
 Identities = 14/39 (35%), Positives = 16/39 (40%), Gaps = 1/39 (2%)
 Frame = +3

Query: 384 PTSPSRPSICPRPSPRSPGSWRTAPRP-PAPGSAAXTPP 497
           PT    PS  P PSP    S   +P P P P  +    P
Sbjct: 341 PTPSPSPSPSPSPSPSPSPSPSPSPSPSPIPSPSPKPSP 379

>pir||S27200 proline-rich protein - mouse gi|220500|dbj|BAA01570.1| NDPP-1
           protein [Mus musculus]
          Length = 389

 Score = 48.9 bits (115), Expect(2) = 5e-08
 Identities = 20/32 (62%), Positives = 20/32 (62%)
 Frame = +1

Query: 241 AIPTHTTPPPPPPPNPPLPPPPAPPSFPLVAC 336
           A P    PPPPPPP PPLPPPP PP   L  C
Sbjct: 28  AAPPPPPPPPPPPPPPPLPPPPLPPLASLSHC 59

 Score = 44.3 bits (103), Expect = 8e-04
 Identities = 20/46 (43%), Positives = 24/46 (51%)
 Frame = +1

Query: 262 PPPPPPPNPPLPPPPAPPSFPLVACIIPSTNTHWQTHARNTQLPPP 399
           PPPPPPP PP PPP  PP  P +A +         +H  +   PPP
Sbjct: 31  PPPPPPPPPPPPPPLPPPPLPPLASL---------SHCGSQASPPP 67

 Score = 39.3 bits (90), Expect = 0.027
 Identities = 15/26 (57%), Positives = 16/26 (60%)
 Frame = +1

Query: 247 PTHTTPPPPPPPNPPLPPPPAPPSFP 324
           P  T+ P  PPP PP PPPP PP  P
Sbjct: 21  PPPTSGPAAPPPPPPPPPPPPPPPLP 46

 Score = 29.3 bits (64), Expect(2) = 5e-08
 Identities = 14/36 (38%), Positives = 18/36 (49%)
 Frame = +3

Query: 387 TSPSRPSICPRPSPRSPGSWRTAPRPPAPGSAAXTP 494
           T  S+PS+ P PS  +P S  T   P    S+A  P
Sbjct: 74  TPSSKPSVLPSPSAAAPASAETPLNPELGDSSASEP 109

>emb|CAB62280.1| hydroxyproline-rich glycoprotein DZ-HRGP [Volvox carteri f.
           nagariensis]
          Length = 409

 Score = 48.1 bits (113), Expect(2) = 6e-08
 Identities = 18/24 (75%), Positives = 18/24 (75%)
 Frame = +1

Query: 247 PTHTTPPPPPPPNPPLPPPPAPPS 318
           P    PPPPPPPNPP PPPP PPS
Sbjct: 126 PPPPPPPPPPPPNPPPPPPPPPPS 149

 Score = 45.4 bits (106), Expect(2) = 8e-07
 Identities = 17/26 (65%), Positives = 18/26 (68%)
 Frame = +1

Query: 247 PTHTTPPPPPPPNPPLPPPPAPPSFP 324
           P+   PPPPPPP PP PPPP PP  P
Sbjct: 109 PSPPPPPPPPPPPPPSPPPPPPPPPP 134

 Score = 45.4 bits (106), Expect(2) = 6e-07
 Identities = 17/26 (65%), Positives = 18/26 (68%)
 Frame = +1

Query: 247 PTHTTPPPPPPPNPPLPPPPAPPSFP 324
           P    PPPPPPP PPLPP P+PP  P
Sbjct: 66  PPPPPPPPPPPPQPPLPPSPSPPPPP 91

 Score = 45.4 bits (106), Expect(2) = 6e-07
 Identities = 17/26 (65%), Positives = 18/26 (68%)
 Frame = +1

Query: 247 PTHTTPPPPPPPNPPLPPPPAPPSFP 324
           P    PPPPPPP+PP PPPP PP  P
Sbjct: 112 PPPPPPPPPPPPSPPPPPPPPPPPPP 137

 Score = 45.4 bits (106), Expect(2) = 4e-07
 Identities = 17/26 (65%), Positives = 19/26 (72%)
 Frame = +1

Query: 247 PTHTTPPPPPPPNPPLPPPPAPPSFP 324
           P+ + PPPPPPP PP PPPP PP  P
Sbjct: 83  PSPSPPPPPPPPVPPPPPPPPPPPPP 108

 Score = 45.4 bits (106), Expect(2) = 8e-07
 Identities = 17/26 (65%), Positives = 18/26 (68%)
 Frame = +1

Query: 247 PTHTTPPPPPPPNPPLPPPPAPPSFP 324
           P    PPPPPPP+PP PPPP PP  P
Sbjct: 98  PPPPPPPPPPPPSPPPPPPPPPPPPP 123

 Score = 45.1 bits (105), Expect(2) = 1e-06
 Identities = 17/26 (65%), Positives = 18/26 (68%)
 Frame = +1

Query: 247 PTHTTPPPPPPPNPPLPPPPAPPSFP 324
           P+   PPPPPPP PP PPPP PP  P
Sbjct: 123 PSPPPPPPPPPPPPPNPPPPPPPPPP 148

 Score = 43.9 bits (102), Expect(2) = 3e-07
 Identities = 21/53 (39%), Positives = 27/53 (50%)
 Frame = +1

Query: 247 PTHTTPPPPPPPNPPLPPPPAPPSFPLVACIIPSTNTHWQTHARNTQLPPPAP 405
           P   +PPP PPP+PP  PPP+PP  P  +   P  +       R    PPP+P
Sbjct: 147 PPSPSPPPSPPPSPPPSPPPSPPPSPPPS---PPPSPPPSPPPRPPPSPPPSP 196

 Score = 43.5 bits (101), Expect(2) = 1e-06
 Identities = 21/53 (39%), Positives = 24/53 (44%)
 Frame = +1

Query: 247 PTHTTPPPPPPPNPPLPPPPAPPSFPLVACIIPSTNTHWQTHARNTQLPPPAP 405
           P   +PPPPPPP PP PP P PP  P      P  +            PPP+P
Sbjct: 120 PPPPSPPPPPPPPPPPPPNPPPPPPPPPPSPSPPPSPPPSPPPSPPPSPPPSP 172

 Score = 43.5 bits (101), Expect(2) = 8e-06
 Identities = 16/26 (61%), Positives = 18/26 (68%)
 Frame = +1

Query: 247 PTHTTPPPPPPPNPPLPPPPAPPSFP 324
           P   +P PPPPP PP+PPPP PP  P
Sbjct: 80  PLPPSPSPPPPPPPPVPPPPPPPPPP 105

 Score = 43.1 bits (100), Expect(2) = 1e-05
 Identities = 17/26 (65%), Positives = 17/26 (65%)
 Frame = +1

Query: 247 PTHTTPPPPPPPNPPLPPPPAPPSFP 324
           P    PPPP PP PP PPPP PPS P
Sbjct: 101 PPPPPPPPPSPPPPPPPPPPPPPSPP 126

 Score = 42.7 bits (99), Expect(2) = 2e-05
 Identities = 17/26 (65%), Positives = 17/26 (65%)
 Frame = +1

Query: 247 PTHTTPPPPPPPNPPLPPPPAPPSFP 324
           P    PPP PPP PP PPPP PPS P
Sbjct: 87  PPPPPPPPVPPPPPPPPPPPPPPSPP 112

 Score = 42.7 bits (99), Expect(2) = 2e-05
 Identities = 22/53 (41%), Positives = 22/53 (41%)
 Frame = +1

Query: 247 PTHTTPPPPPPPNPPLPPPPAPPSFPLVACIIPSTNTHWQTHARNTQLPPPAP 405
           P    PPPPPPP PP  PPP PP  P      P           N   PPP P
Sbjct: 94  PVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPPPPP 146

 Score = 42.7 bits (99), Expect(2) = 1e-05
 Identities = 16/27 (59%), Positives = 18/27 (66%)
 Frame = +1

Query: 244 IPTHTTPPPPPPPNPPLPPPPAPPSFP 324
           +P   +PPPPPPP  P PPPP PP  P
Sbjct: 81  LPPSPSPPPPPPPPVPPPPPPPPPPPP 107

 Score = 42.4 bits (98), Expect(2) = 2e-05
 Identities = 16/27 (59%), Positives = 17/27 (62%)
 Frame = +1

Query: 244 IPTHTTPPPPPPPNPPLPPPPAPPSFP 324
           +P    PPPPPPP P  PPPP PP  P
Sbjct: 95  VPPPPPPPPPPPPPPSPPPPPPPPPPP 121

 Score = 42.0 bits (97), Expect(2) = 3e-05
 Identities = 17/26 (65%), Positives = 18/26 (68%)
 Frame = +1

Query: 247 PTHTTPPPPPPPNPPLPPPPAPPSFP 324
           P    PPPPPPP PP PPPP+PP  P
Sbjct: 91  PPPPVPPPPPPPPPP-PPPPSPPPPP 115

 Score = 41.6 bits (96), Expect(2) = 3e-06
 Identities = 24/55 (43%), Positives = 28/55 (50%), Gaps = 2/55 (3%)
 Frame = +1

Query: 247 PTHTTPPPPPPPNPPLPPPPA--PPSFPLVACIIPSTNTHWQTHARNTQLPPPAP 405
           P    PPPP PP PPLPPPP+  PPS P  + + PS      +   N    PP P
Sbjct: 261 PPPPLPPPPSPP-PPLPPPPSPPPPSPPPPSPLPPSPRPPKPSPPNNPFPRPPPP 314

 Score = 41.6 bits (96), Expect(2) = 9e-05
 Identities = 16/26 (61%), Positives = 16/26 (61%)
 Frame = +1

Query: 247 PTHTTPPPPPPPNPPLPPPPAPPSFP 324
           P    PPPPPPP PP PP P PP  P
Sbjct: 92  PPPVPPPPPPPPPPPPPPSPPPPPPP 117

 Score = 41.2 bits (95), Expect(2) = 1e-05
 Identities = 14/17 (82%), Positives = 15/17 (87%)
 Frame = +1

Query: 265 PPPPPPNPPLPPPPAPP 315
           PPPP PNPP PPPP+PP
Sbjct: 321 PPPPSPNPPRPPPPSPP 337

 Score = 41.2 bits (95), Expect(2) = 8e-06
 Identities = 20/51 (39%), Positives = 26/51 (50%), Gaps = 2/51 (3%)
 Frame = +1

Query: 259 TPPPPPPPNPPLPPPPAPPSFPLVACIIPSTNT--HWQTHARNTQLPPPAP 405
           +PPP PPP+PP  PPP PP  P      P + +    +   R    PPP+P
Sbjct: 191 SPPPSPPPSPPPSPPPRPPPSPNPPSPRPPSPSPPSPRPPPRRPPFPPPSP 241

 Score = 40.8 bits (94), Expect(2) = 2e-05
 Identities = 22/48 (45%), Positives = 25/48 (51%)
 Frame = +1

Query: 265 PPPPPPNPPLPPPPAPPSFPLVACIIPSTNTHWQTHARNTQLPPPAPL 408
           PPPP P PPLPPPP+PP  PL     P   +           PPP+PL
Sbjct: 256 PPPPSPPPPLPPPPSPPP-PLPPPPSPPPPSP----------PPPSPL 292

 Score = 40.8 bits (94), Expect(2) = 3e-04
 Identities = 16/26 (61%), Positives = 16/26 (61%)
 Frame = +1

Query: 247 PTHTTPPPPPPPNPPLPPPPAPPSFP 324
           P    PPPPPPP PP P PP PP  P
Sbjct: 93  PPVPPPPPPPPPPPPPPSPPPPPPPP 118

 Score = 40.0 bits (92), Expect(2) = 3e-05
 Identities = 16/26 (61%), Positives = 17/26 (64%)
 Frame = +1

Query: 247 PTHTTPPPPPPPNPPLPPPPAPPSFP 324
           PT + P  PPPP PP PPPP PP  P
Sbjct: 58  PTPSGPEHPPPPPPPPPPPPQPPLPP 83

 Score = 40.0 bits (92), Expect(2) = 1e-05
 Identities = 14/22 (63%), Positives = 17/22 (76%)
 Frame = +1

Query: 259 TPPPPPPPNPPLPPPPAPPSFP 324
           +PPP PPP+PP  PPP+PP  P
Sbjct: 183 SPPPRPPPSPPPSPPPSPPPSP 204

 Score = 40.0 bits (92), Expect(2) = 2e-07
 Identities = 14/22 (63%), Positives = 16/22 (72%)
 Frame = +1

Query: 259 TPPPPPPPNPPLPPPPAPPSFP 324
           +PPP PPP PP  PPP+PP  P
Sbjct: 179 SPPPSPPPRPPPSPPPSPPPSP 200

 Score = 39.3 bits (90), Expect(2) = 9e-05
 Identities = 15/23 (65%), Positives = 15/23 (65%)
 Frame = +1

Query: 247 PTHTTPPPPPPPNPPLPPPPAPP 315
           P    P PPP P PP PPPPAPP
Sbjct: 230 PPRRPPFPPPSPPPPRPPPPAPP 252

 Score = 38.9 bits (89), Expect(2) = 1e-04
 Identities = 17/33 (51%), Positives = 18/33 (54%), Gaps = 6/33 (18%)
 Frame = +1

Query: 247 PTHTTPPPPP------PPNPPLPPPPAPPSFPL 327
           P H  PPPPP      PP PP P PP PP  P+
Sbjct: 63  PEHPPPPPPPPPPPPQPPLPPSPSPPPPPPPPV 95

 Score = 38.5 bits (88), Expect = 0.046
 Identities = 13/16 (81%), Positives = 14/16 (87%)
 Frame = +1

Query: 265 PPPPPPNPPLPPPPAP 312
           PPPP PNPP PPPP+P
Sbjct: 341 PPPPSPNPPRPPPPSP 356

 Score = 38.5 bits (88), Expect(2) = 7e-05
 Identities = 15/24 (62%), Positives = 18/24 (74%)
 Frame = +1

Query: 244 IPTHTTPPPPPPPNPPLPPPPAPP 315
           +P   +PPPP PP PP PPPP+PP
Sbjct: 265 LPPPPSPPPPLPP-PPSPPPPSPP 287

 Score = 38.5 bits (88), Expect = 0.046
 Identities = 15/26 (57%), Positives = 16/26 (60%)
 Frame = +1

Query: 247 PTHTTPPPPPPPNPPLPPPPAPPSFP 324
           P    PP PPPP+P  P PP PPS P
Sbjct: 343 PPSPNPPRPPPPSPSPPKPPPPPSPP 368

 Score = 38.1 bits (87), Expect(2) = 1e-04
 Identities = 19/37 (51%), Positives = 21/37 (56%), Gaps = 1/37 (2%)
 Frame = +1

Query: 208 PLLLVPCSCLAAIPTHTTPPPP-PPPNPPLPPPPAPP 315
           P L  P S    +P   +PPPP PPP  PLPP P PP
Sbjct: 263 PPLPPPPSPPPPLPPPPSPPPPSPPPPSPLPPSPRPP 299

 Score = 38.1 bits (87), Expect(2) = 5e-05
 Identities = 15/26 (57%), Positives = 16/26 (60%)
 Frame = +1

Query: 247 PTHTTPPPPPPPNPPLPPPPAPPSFP 324
           P  + PP PPP  PP PPP  PPS P
Sbjct: 172 PPPSPPPSPPPSPPPRPPPSPPPSPP 197

 Score = 37.7 bits (86), Expect(2) = 9e-04
 Identities = 15/26 (57%), Positives = 16/26 (60%)
 Frame = +1

Query: 247 PTHTTPPPPPPPNPPLPPPPAPPSFP 324
           P  + PP PPP  PP PPP  PPS P
Sbjct: 180 PPPSPPPRPPPSPPPSPPPSPPPSPP 205

 Score = 37.7 bits (86), Expect(2) = 0.001
 Identities = 15/26 (57%), Positives = 16/26 (60%)
 Frame = +1

Query: 247 PTHTTPPPPPPPNPPLPPPPAPPSFP 324
           P  + PP PPP  PP PPP  PPS P
Sbjct: 176 PPPSPPPSPPPRPPPSPPPSPPPSPP 201

 Score = 37.7 bits (86), Expect(2) = 0.005
 Identities = 15/26 (57%), Positives = 15/26 (57%)
 Frame = +1

Query: 247 PTHTTPPPPPPPNPPLPPPPAPPSFP 324
           P    P PPPPP PP PPPP  P  P
Sbjct: 89  PPPPPPVPPPPPPPPPPPPPPSPPPP 114

 Score = 37.4 bits (85), Expect(2) = 0.002
 Identities = 13/17 (76%), Positives = 13/17 (76%)
 Frame = +1

Query: 265 PPPPPPNPPLPPPPAPP 315
           PPPP P PP PPPP PP
Sbjct: 241 PPPPRPPPPAPPPPRPP 257

 Score = 37.4 bits (85), Expect(2) = 2e-04
 Identities = 23/54 (42%), Positives = 25/54 (45%), Gaps = 1/54 (1%)
 Frame = +1

Query: 247 PTHTTPPPPPPPNPPLPPPPAP-PSFPLVACIIPSTNTHWQTHARNTQLPPPAP 405
           P    PPPP PP PP PPPP+P P  P      P  N   +    N   PPP P
Sbjct: 271 PPPPLPPPPSPP-PPSPPPPSPLPPSPRPPKPSPPNNPFPRPPPPNP--PPPRP 321

 Score = 37.0 bits (84), Expect(2) = 0.001
 Identities = 26/74 (35%), Positives = 28/74 (37%), Gaps = 9/74 (12%)
 Frame = +1

Query: 211 LLLVPCSCLAAIPTHTTPPP--PPP-------PNPPLPPPPAPPSFPLVACIIPSTNTHW 363
           L+  P +     P   TPPP  PPP       P PP PPPP PP  PL     P      
Sbjct: 34  LVETPAAPPPGSPPPGTPPPGVPPPTPSGPEHPPPPPPPPPPPPQPPLPPSPSPPPPPPP 93

Query: 364 QTHARNTQLPPPAP 405
                    PPP P
Sbjct: 94  PVPPPPPPPPPPPP 107

 Score = 37.0 bits (84), Expect = 0.13
 Identities = 14/26 (53%), Positives = 17/26 (64%)
 Frame = +1

Query: 247 PTHTTPPPPPPPNPPLPPPPAPPSFP 324
           P+ + P PPPPP+PP  PP  PP  P
Sbjct: 354 PSPSPPKPPPPPSPPPRPPRRPPRPP 379

 Score = 36.6 bits (83), Expect = 0.17
 Identities = 14/26 (53%), Positives = 15/26 (56%)
 Frame = +1

Query: 247 PTHTTPPPPPPPNPPLPPPPAPPSFP 324
           P    PPPP P  P  PPPP+PP  P
Sbjct: 346 PNPPRPPPPSPSPPKPPPPPSPPPRP 371

 Score = 36.6 bits (83), Expect(2) = 4e-04
 Identities = 15/24 (62%), Positives = 16/24 (66%)
 Frame = +1

Query: 247 PTHTTPPPPPPPNPPLPPPPAPPS 318
           P    PP PPPP+PP PP P PPS
Sbjct: 323 PPSPNPPRPPPPSPP-PPRPPPPS 345

 Score = 36.2 bits (82), Expect = 0.23
 Identities = 22/54 (40%), Positives = 25/54 (45%), Gaps = 7/54 (12%)
 Frame = +1

Query: 265 PPPPPPNPPLPPPPA-------PPSFPLVACIIPSTNTHWQTHARNTQLPPPAP 405
           PPPP P PP PPPP+       PPS P      PS N          + PPP+P
Sbjct: 311 PPPPNPPPPRPPPPSPNPPRPPPPSPPPPRPPPPSPNP--------PRPPPPSP 356

 Score = 36.2 bits (82), Expect(2) = 2e-07
 Identities = 20/44 (45%), Positives = 22/44 (49%)
 Frame = +3

Query: 366 NTRTQHPTSPSRPSICPRPSPRSPGSWRTAPRPPAPGSAAXTPP 497
           N  +  P SPS PS  PRP PR P     +P PP P   A  PP
Sbjct: 213 NPPSPRPPSPSPPS--PRPPPRRPPFPPPSPPPPRPPPPAPPPP 254

 Score = 35.8 bits (81), Expect(2) = 0.005
 Identities = 21/53 (39%), Positives = 22/53 (40%)
 Frame = +1

Query: 247 PTHTTPPPPPPPNPPLPPPPAPPSFPLVACIIPSTNTHWQTHARNTQLPPPAP 405
           P    PP PPP  PP PPP  PP  P      PS N       R     PP+P
Sbjct: 184 PPPRPPPSPPPSPPPSPPPSPPPRPP------PSPN---PPSPRPPSPSPPSP 227

 Score = 33.9 bits (76), Expect(2) = 0.024
 Identities = 14/27 (51%), Positives = 16/27 (58%), Gaps = 1/27 (3%)
 Frame = +1

Query: 247 PTHTTPPPPPPPN-PPLPPPPAPPSFP 324
           P+ + P P PPP  PP PPP  PP  P
Sbjct: 220 PSPSPPSPRPPPRRPPFPPPSPPPPRP 246

 Score = 33.9 bits (76), Expect = 1.1
 Identities = 14/26 (53%), Positives = 15/26 (56%)
 Frame = +1

Query: 247 PTHTTPPPPPPPNPPLPPPPAPPSFP 324
           P    PP P PP PP PP P+PP  P
Sbjct: 338 PPRPPPPSPNPPRPP-PPSPSPPKPP 362

 Score = 33.5 bits (75), Expect = 1.5
 Identities = 13/23 (56%), Positives = 14/23 (60%)
 Frame = +1

Query: 247 PTHTTPPPPPPPNPPLPPPPAPP 315
           P+   PP  PP  PP PPPP PP
Sbjct: 225 PSPRPPPRRPPFPPPSPPPPRPP 247

 Score = 33.5 bits (75), Expect = 1.5
 Identities = 16/36 (44%), Positives = 17/36 (46%), Gaps = 3/36 (8%)
 Frame = +1

Query: 247 PTHTTPPPPPPPNPPL---PPPPAPPSFPLVACIIP 345
           P    PPP PPP PP     PP  PP+ P V    P
Sbjct: 358 PPKPPPPPSPPPRPPRRPPRPPRRPPTAPGVVGFFP 393

 Score = 33.5 bits (75), Expect = 1.5
 Identities = 16/35 (45%), Positives = 17/35 (47%), Gaps = 6/35 (17%)
 Frame = +1

Query: 247 PTHTTPPPPPPPNPPLPP------PPAPPSFPLVA 333
           P   +P PP PP PP PP      PP PP  P  A
Sbjct: 351 PPPPSPSPPKPPPPPSPPPRPPRRPPRPPRRPPTA 385

 Score = 32.3 bits (72), Expect(2) = 0.011
 Identities = 21/57 (36%), Positives = 24/57 (41%), Gaps = 3/57 (5%)
 Frame = +1

Query: 244 IPTHTTPPPPPPPNPPLP---PPPAPPSFPLVACIIPSTNTHWQTHARNTQLPPPAP 405
           +P    PP P PPN P P   PP  PP  P      PS N          + PPP+P
Sbjct: 292 LPPSPRPPKPSPPNNPFPRPPPPNPPPPRPPP----PSPNP--------PRPPPPSP 336

 Score = 31.6 bits (70), Expect(2) = 3e-07
 Identities = 15/38 (39%), Positives = 19/38 (49%)
 Frame = +3

Query: 384 PTSPSRPSICPRPSPRSPGSWRTAPRPPAPGSAAXTPP 497
           P+ P  P   P PSP  P     +PRPP+P   +  PP
Sbjct: 198 PSPPPSPPPRPPPSPNPP-----SPRPPSPSPPSPRPP 230

 Score = 31.6 bits (70), Expect = 5.6
 Identities = 16/30 (53%), Positives = 16/30 (53%), Gaps = 4/30 (13%)
 Frame = +1

Query: 247 PTHTTPPPP---PP-PNPPLPPPPAPPSFP 324
           P    PPPP   PP P PP P PP PP  P
Sbjct: 336 PPPPRPPPPSPNPPRPPPPSPSPPKPPPPP 365

 Score = 30.4 bits (67), Expect(2) = 3e-06
 Identities = 17/38 (44%), Positives = 18/38 (46%)
 Frame = +3

Query: 384 PTSPSRPSICPRPSPRSPGSWRTAPRPPAPGSAAXTPP 497
           P  PS P   PRP P SP      PRPP P  +   PP
Sbjct: 331 PPPPSPPP--PRPPPPSPNP----PRPPPPSPSPPKPP 362

 Score = 30.0 bits (66), Expect(2) = 1e-06
 Identities = 17/39 (43%), Positives = 19/39 (48%), Gaps = 1/39 (2%)
 Frame = +3

Query: 384 PTSPSRPSICPR-PSPRSPGSWRTAPRPPAPGSAAXTPP 497
           P+ P RP   P  PSPR P     +PRPP P      PP
Sbjct: 202 PSPPPRPPPSPNPPSPRPPSPSPPSPRPP-PRRPPFPPP 239

 Score = 29.6 bits (65), Expect(2) = 5e-05
 Identities = 17/38 (44%), Positives = 20/38 (51%)
 Frame = +3

Query: 384 PTSPSRPSICPRPSPRSPGSWRTAPRPPAPGSAAXTPP 497
           P SP  PS  P P PR P S    P PP+P   + +PP
Sbjct: 193 PPSPP-PSPPPSPPPRPPPS----PNPPSPRPPSPSPP 225

 Score = 29.6 bits (65), Expect(2) = 6e-08
 Identities = 15/38 (39%), Positives = 17/38 (44%)
 Frame = +3

Query: 384 PTSPSRPSICPRPSPRSPGSWRTAPRPPAPGSAAXTPP 497
           P  P  PS  P P P  P S   +P P  P S   +PP
Sbjct: 144 PPPPPSPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPP 181

 Score = 29.6 bits (65), Expect(2) = 4e-07
 Identities = 15/38 (39%), Positives = 18/38 (46%)
 Frame = +3

Query: 384 PTSPSRPSICPRPSPRSPGSWRTAPRPPAPGSAAXTPP 497
           P +P  P   P PSP  P S   +P P  P S   +PP
Sbjct: 136 PPNPPPPPPPPPPSPSPPPSPPPSPPPSPPPSPPPSPP 173

 Score = 29.6 bits (65), Expect(2) = 1e-05
 Identities = 19/43 (44%), Positives = 21/43 (48%), Gaps = 5/43 (11%)
 Frame = +3

Query: 384 PTSPSRPSICPRPSPRSPGSWRTAPR-----PPAPGSAAXTPP 497
           P SP+ PS  PRP   SP S R  PR     PP+P      PP
Sbjct: 209 PPSPNPPS--PRPPSPSPPSPRPPPRRPPFPPPSPPPPRPPPP 249

 Score = 29.3 bits (64), Expect(2) = 8e-06
 Identities = 15/38 (39%), Positives = 19/38 (49%)
 Frame = +3

Query: 384 PTSPSRPSICPRPSPRSPGSWRTAPRPPAPGSAAXTPP 497
           P SP  P + P PSP  P     +P PP+P     +PP
Sbjct: 268 PPSPP-PPLPPPPSPPPPSPPPPSPLPPSPRPPKPSPP 304

 Score = 28.9 bits (63), Expect(2) = 7e-05
 Identities = 17/44 (38%), Positives = 18/44 (40%)
 Frame = +3

Query: 366 NTRTQHPTSPSRPSICPRPSPRSPGSWRTAPRPPAPGSAAXTPP 497
           N     P  P+ P   PRP P SP      PRPP P      PP
Sbjct: 305 NNPFPRPPPPNPPP--PRPPPPSPNP----PRPPPPSPPPPRPP 342

 Score = 28.9 bits (63), Expect(2) = 6e-07
 Identities = 17/38 (44%), Positives = 18/38 (46%)
 Frame = +3

Query: 384 PTSPSRPSICPRPSPRSPGSWRTAPRPPAPGSAAXTPP 497
           P SP  PS  P P PR P S   +P P  P S    PP
Sbjct: 173 PPSPP-PSPPPSPPPRPPPSPPPSPPPSPPPSPPPRPP 209

 Score = 28.9 bits (63), Expect(2) = 6e-07
 Identities = 15/38 (39%), Positives = 15/38 (39%)
 Frame = +3

Query: 384 PTSPSRPSICPRPSPRSPGSWRTAPRPPAPGSAAXTPP 497
           P SP  P   P P P SP      P PP P      PP
Sbjct: 108 PPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPPPP 145

 Score = 28.5 bits (62), Expect(2) = 3e-05
 Identities = 15/38 (39%), Positives = 16/38 (41%)
 Frame = +3

Query: 384 PTSPSRPSICPRPSPRSPGSWRTAPRPPAPGSAAXTPP 497
           P SPS P   P P P  P      P PP+P      PP
Sbjct: 82  PPSPSPPPPPPPPVPPPPPPPPPPPPPPSPPPPPPPPP 119

 Score = 28.5 bits (62), Expect(2) = 1e-05
 Identities = 19/42 (45%), Positives = 19/42 (45%), Gaps = 5/42 (11%)
 Frame = +3

Query: 384 PTSPSRPSICPRPSPRSPGSWRTAPRPP-----APGSAAXTP 494
           P SPS P   P PSP  P   R  PRPP     APG     P
Sbjct: 353 PPSPSPPKPPPPPSP-PPRPPRRPPRPPRRPPTAPGVVGFFP 393

 Score = 28.5 bits (62), Expect(2) = 2e-05
 Identities = 15/38 (39%), Positives = 19/38 (49%)
 Frame = +3

Query: 384 PTSPSRPSICPRPSPRSPGSWRTAPRPPAPGSAAXTPP 497
           P SP+ P   P PSP  P     +P PP P   + +PP
Sbjct: 323 PPSPNPPRP-PPPSPPPPRPPPPSPNPPRPPPPSPSPP 359

 Score = 28.5 bits (62), Expect(2) = 8e-07
 Identities = 17/39 (43%), Positives = 19/39 (48%), Gaps = 1/39 (2%)
 Frame = +3

Query: 384 PTSPSRP-SICPRPSPRSPGSWRTAPRPPAPGSAAXTPP 497
           P SPS P S  P P P  P S   +P P  P S   +PP
Sbjct: 147 PPSPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPPPSPP 185

 Score = 28.5 bits (62), Expect(2) = 8e-07
 Identities = 14/38 (36%), Positives = 15/38 (38%)
 Frame = +3

Query: 384 PTSPSRPSICPRPSPRSPGSWRTAPRPPAPGSAAXTPP 497
           P  P  PS  P P P  P      P PP P  +   PP
Sbjct: 117 PPPPPPPSPPPPPPPPPPPPPNPPPPPPPPPPSPSPPP 154

 Score = 28.5 bits (62), Expect(2) = 1e-04
 Identities = 14/35 (40%), Positives = 15/35 (42%)
 Frame = +3

Query: 393 PSRPSICPRPSPRSPGSWRTAPRPPAPGSAAXTPP 497
           P +PS    P PR P      PRPP P      PP
Sbjct: 298 PPKPSPPNNPFPRPPPPNPPPPRPPPPSPNPPRPP 332

 Score = 28.1 bits (61), Expect(2) = 1e-06
 Identities = 14/38 (36%), Positives = 16/38 (41%)
 Frame = +3

Query: 384 PTSPSRPSICPRPSPRSPGSWRTAPRPPAPGSAAXTPP 497
           P  P  P   P P P  P S   +P P  P S   +PP
Sbjct: 140 PPPPPPPPPSPSPPPSPPPSPPPSPPPSPPPSPPPSPP 177

 Score = 28.1 bits (61), Expect(2) = 4e-04
 Identities = 17/39 (43%), Positives = 19/39 (48%), Gaps = 1/39 (2%)
 Frame = +3

Query: 384 PTSPSRPSICP-RPSPRSPGSWRTAPRPPAPGSAAXTPP 497
           P  P  PS  P RP P SP    + P+PP P S    PP
Sbjct: 338 PPRPPPPSPNPPRPPPPSP----SPPKPPPPPSPPPRPP 372

 Score = 28.1 bits (61), Expect(2) = 2e-04
 Identities = 15/39 (38%), Positives = 16/39 (40%)
 Frame = +3

Query: 381 HPTSPSRPSICPRPSPRSPGSWRTAPRPPAPGSAAXTPP 497
           +P  P  P   P P PR P      PRPP P      PP
Sbjct: 315 NPPPPRPPPPSPNP-PRPPPPSPPPPRPPPPSPNPPRPP 352

 Score = 27.7 bits (60), Expect(2) = 9e-05
 Identities = 15/38 (39%), Positives = 19/38 (49%)
 Frame = +3

Query: 384 PTSPSRPSICPRPSPRSPGSWRTAPRPPAPGSAAXTPP 497
           P SP  P + P PSP  P     +P PP+P   +  PP
Sbjct: 258 PPSPP-PPLPPPPSPPPPLPPPPSPPPPSPPPPSPLPP 294

 Score = 27.3 bits (59), Expect(2) = 0.011
 Identities = 15/38 (39%), Positives = 16/38 (41%)
 Frame = +3

Query: 384 PTSPSRPSICPRPSPRSPGSWRTAPRPPAPGSAAXTPP 497
           P SP  P   P PSP  P     +P PP P      PP
Sbjct: 333 PPSPPPPRP-PPPSPNPPRPPPPSPSPPKPPPPPSPPP 369

 Score = 27.3 bits (59), Expect(2) = 1e-04
 Identities = 14/38 (36%), Positives = 14/38 (36%)
 Frame = +3

Query: 384 PTSPSRPSICPRPSPRSPGSWRTAPRPPAPGSAAXTPP 497
           P  P  P   P P P SP      P PP P      PP
Sbjct: 94  PVPPPPPPPPPPPPPPSPPPPPPPPPPPPPSPPPPPPP 131

 Score = 26.9 bits (58), Expect(2) = 1e-05
 Identities = 14/38 (36%), Positives = 14/38 (36%)
 Frame = +3

Query: 384 PTSPSRPSICPRPSPRSPGSWRTAPRPPAPGSAAXTPP 497
           P  P  PS  P P P  P      P PP P      PP
Sbjct: 103 PPPPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPP 140

 Score = 26.9 bits (58), Expect(2) = 8e-06
 Identities = 13/38 (34%), Positives = 14/38 (36%)
 Frame = +3

Query: 384 PTSPSRPSICPRPSPRSPGSWRTAPRPPAPGSAAXTPP 497
           P  P  P   P P P SP    + P  P P      PP
Sbjct: 133 PPPPPNPPPPPPPPPPSPSPPPSPPPSPPPSPPPSPPP 170

 Score = 26.9 bits (58), Expect(2) = 1e-05
 Identities = 16/38 (42%), Positives = 18/38 (47%)
 Frame = +3

Query: 384 PTSPSRPSICPRPSPRSPGSWRTAPRPPAPGSAAXTPP 497
           P SP  PS  P P P  P S   +P P  P S   +PP
Sbjct: 161 PPSPP-PSPPPSPPPSPPPSPPPSPPPRPPPSPPPSPP 197

 Score = 26.6 bits (57), Expect(2) = 3e-05
 Identities = 14/38 (36%), Positives = 15/38 (38%)
 Frame = +3

Query: 384 PTSPSRPSICPRPSPRSPGSWRTAPRPPAPGSAAXTPP 497
           P  PS P   P P P  P      P PP   S   +PP
Sbjct: 120 PPPPSPPPPPPPPPPPPPNPPPPPPPPPPSPSPPPSPP 157

 Score = 26.6 bits (57), Expect(2) = 2e-05
 Identities = 14/38 (36%), Positives = 14/38 (36%)
 Frame = +3

Query: 384 PTSPSRPSICPRPSPRSPGSWRTAPRPPAPGSAAXTPP 497
           P  PS P   P P P  P      P PP P      PP
Sbjct: 106 PPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPPP 143

 Score = 26.6 bits (57), Expect(2) = 2e-05
 Identities = 16/38 (42%), Positives = 17/38 (44%)
 Frame = +3

Query: 384 PTSPSRPSICPRPSPRSPGSWRTAPRPPAPGSAAXTPP 497
           P SP  PS  P P P  P S   +P P  P S    PP
Sbjct: 153 PPSPP-PSPPPSPPPSPPPSPPPSPPPSPPPSPPPRPP 189

 Score = 26.6 bits (57), Expect(2) = 2e-05
 Identities = 13/38 (34%), Positives = 15/38 (39%)
 Frame = +3

Query: 384 PTSPSRPSICPRPSPRSPGSWRTAPRPPAPGSAAXTPP 497
           P  P  P   P P P  P      P PP P   + +PP
Sbjct: 116 PPPPPPPPSPPPPPPPPPPPPPNPPPPPPPPPPSPSPP 153

 Score = 26.2 bits (56), Expect(2) = 0.001
 Identities = 14/38 (36%), Positives = 14/38 (36%)
 Frame = +3

Query: 384 PTSPSRPSICPRPSPRSPGSWRTAPRPPAPGSAAXTPP 497
           P  P  P   P P P  P S    P PP P      PP
Sbjct: 105 PPPPPSPPPPPPPPPPPPPSPPPPPPPPPPPPPNPPPP 142

 Score = 25.8 bits (55), Expect(2) = 9e-04
 Identities = 13/35 (37%), Positives = 13/35 (37%)
 Frame = +3

Query: 393 PSRPSICPRPSPRSPGSWRTAPRPPAPGSAAXTPP 497
           P RP     P PR P      P PP P      PP
Sbjct: 243 PPRPPPPAPPPPRPPPPSPPPPLPPPPSPPPPLPP 277

 Score = 25.4 bits (54), Expect(2) = 9e-05
 Identities = 15/38 (39%), Positives = 17/38 (44%)
 Frame = +3

Query: 384 PTSPSRPSICPRPSPRSPGSWRTAPRPPAPGSAAXTPP 497
           P SP  PS  P P P  P S   +P P  P     +PP
Sbjct: 157 PPSPP-PSPPPSPPPSPPPSPPPSPPPSPPPRPPPSPP 193

 Score = 25.0 bits (53), Expect(2) = 0.005
 Identities = 15/38 (39%), Positives = 17/38 (44%)
 Frame = +3

Query: 384 PTSPSRPSICPRPSPRSPGSWRTAPRPPAPGSAAXTPP 497
           P  P+ P   PRP P SP      P PP+P      PP
Sbjct: 246 PPPPAPPP--PRPPPPSPPP--PLPPPPSPPPPLPPPP 279

 Score = 25.0 bits (53), Expect(2) = 0.001
 Identities = 14/38 (36%), Positives = 17/38 (43%)
 Frame = +3

Query: 384 PTSPSRPSICPRPSPRSPGSWRTAPRPPAPGSAAXTPP 497
           P SP  P   P P+P  P     +P PP P   +  PP
Sbjct: 238 PPSPPPPRP-PPPAPPPPRPPPPSPPPPLPPPPSPPPP 274

 Score = 25.0 bits (53), Expect(2) = 0.002
 Identities = 14/35 (40%), Positives = 16/35 (45%)
 Frame = +3

Query: 393 PSRPSICPRPSPRSPGSWRTAPRPPAPGSAAXTPP 497
           P RP   P PSP  P     +P PP P   +  PP
Sbjct: 253 PPRP---PPPSPPPPLPPPPSPPPPLPPPPSPPPP 284

 Score = 24.6 bits (52), Expect(2) = 0.024
 Identities = 15/38 (39%), Positives = 16/38 (41%)
 Frame = +3

Query: 384 PTSPSRPSICPRPSPRSPGSWRTAPRPPAPGSAAXTPP 497
           P  PS P   P P P SP      P PP P     +PP
Sbjct: 256 PPPPSPPP--PLPPPPSP----PPPLPPPPSPPPPSPP 287

 Score = 24.3 bits (51), Expect(2) = 3e-04
 Identities = 14/38 (36%), Positives = 14/38 (36%)
 Frame = +3

Query: 384 PTSPSRPSICPRPSPRSPGSWRTAPRPPAPGSAAXTPP 497
           P  P  P   P P P  P S    P PP P      PP
Sbjct: 130 PPPPPPPPNPPPPPPPPPPSPSPPPSPP-PSPPPSPPP 166

 Score = 23.1 bits (48), Expect(2) = 0.005
 Identities = 14/41 (34%), Positives = 15/41 (36%), Gaps = 3/41 (7%)
 Frame = +3

Query: 384 PTSPSRPSICPRPSPRSPGSWRTAPRP---PAPGSAAXTPP 497
           P SP  P   P P P +P      P P   P P      PP
Sbjct: 122 PPSPPPPPPPPPPPPPNPPPPPPPPPPSPSPPPSPPPSPPP 162

>dbj|BAC57890.1| pherophorin [Volvox carteri f. nagariensis]
          Length = 606

 Score = 47.0 bits (110), Expect = 1e-04
 Identities = 23/53 (43%), Positives = 27/53 (50%)
 Frame = +1

Query: 247 PTHTTPPPPPPPNPPLPPPPAPPSFPLVACIIPSTNTHWQTHARNTQLPPPAP 405
           P  + PPPPPPP PP PPPP PP  P      PS        + +   PPP+P
Sbjct: 225 PPPSPPPPPPPPPPPSPPPPPPPPPP------PSPPPPPPPPSPSPPPPPPSP 271

 Score = 47.0 bits (110), Expect = 1e-04
 Identities = 24/53 (45%), Positives = 26/53 (48%)
 Frame = +1

Query: 247 PTHTTPPPPPPPNPPLPPPPAPPSFPLVACIIPSTNTHWQTHARNTQLPPPAP 405
           P  + PPPPPPP PP PPPP PP  P      PS +            PPPAP
Sbjct: 237 PPPSPPPPPPPPPPPSPPPPPPPPSPSPPPPPPSPS---PPPPPPPPSPPPAP 286

 Score = 45.4 bits (106), Expect(2) = 8e-07
 Identities = 16/21 (76%), Positives = 17/21 (80%)
 Frame = +1

Query: 262 PPPPPPPNPPLPPPPAPPSFP 324
           PPPPPPP+PP PPPP PP  P
Sbjct: 221 PPPPPPPSPPPPPPPPPPPSP 241

 Score = 45.4 bits (106), Expect(2) = 8e-08
 Identities = 17/26 (65%), Positives = 18/26 (68%)
 Frame = +1

Query: 247 PTHTTPPPPPPPNPPLPPPPAPPSFP 324
           P  + PPPPPPP PP PPPP PP  P
Sbjct: 213 PPPSPPPPPPPPPPPSPPPPPPPPPP 238

 Score = 45.4 bits (106), Expect(2) = 3e-07
 Identities = 16/21 (76%), Positives = 17/21 (80%)
 Frame = +1

Query: 262 PPPPPPPNPPLPPPPAPPSFP 324
           PPPPPPP+PP PPPP PP  P
Sbjct: 209 PPPPPPPSPPPPPPPPPPPSP 229

 Score = 43.9 bits (102), Expect(2) = 2e-06
 Identities = 16/21 (76%), Positives = 16/21 (76%)
 Frame = +1

Query: 262 PPPPPPPNPPLPPPPAPPSFP 324
           PPPPPPP PP PPPP PP  P
Sbjct: 206 PPPPPPPPPPSPPPPPPPPPP 226

 Score = 43.5 bits (101), Expect = 0.001
 Identities = 22/53 (41%), Positives = 24/53 (44%)
 Frame = +1

Query: 247 PTHTTPPPPPPPNPPLPPPPAPPSFPLVACIIPSTNTHWQTHARNTQLPPPAP 405
           P    PPPPPP  PP PPPP PPS P      P  +        +   PPP P
Sbjct: 217 PPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPSPSPPPPPP 269

 Score = 43.1 bits (100), Expect(2) = 5e-06
 Identities = 17/26 (65%), Positives = 17/26 (65%)
 Frame = +1

Query: 247 PTHTTPPPPPPPNPPLPPPPAPPSFP 324
           P    PPPPPP  PP PPPP PPS P
Sbjct: 205 PPPPPPPPPPPSPPPPPPPPPPPSPP 230

 Score = 42.0 bits (97), Expect(2) = 2e-05
 Identities = 16/26 (61%), Positives = 17/26 (64%)
 Frame = +1

Query: 247 PTHTTPPPPPPPNPPLPPPPAPPSFP 324
           P    PPP PPP PP PPPP+PP  P
Sbjct: 208 PPPPPPPPSPPPPPPPPPPPSPPPPP 233

 Score = 42.0 bits (97), Expect(2) = 1e-05
 Identities = 16/26 (61%), Positives = 17/26 (64%)
 Frame = +1

Query: 247 PTHTTPPPPPPPNPPLPPPPAPPSFP 324
           P   +PPPPPPP PP  PPP PP  P
Sbjct: 212 PPPPSPPPPPPPPPPPSPPPPPPPPP 237

 Score = 41.6 bits (96), Expect(2) = 3e-05
 Identities = 17/31 (54%), Positives = 17/31 (54%)
 Frame = +1

Query: 232 CLAAIPTHTTPPPPPPPNPPLPPPPAPPSFP 324
           C   I     PPPPPPP PP  PPP PP  P
Sbjct: 195 CPQNIVVEPQPPPPPPPPPPPSPPPPPPPPP 225

 Score = 41.6 bits (96), Expect(2) = 5e-05
 Identities = 16/26 (61%), Positives = 16/26 (61%)
 Frame = +1

Query: 247 PTHTTPPPPPPPNPPLPPPPAPPSFP 324
           P    PPPPPPP P  PPPP PP  P
Sbjct: 214 PPSPPPPPPPPPPPSPPPPPPPPPPP 239

 Score = 41.6 bits (96), Expect = 0.005
 Identities = 15/25 (60%), Positives = 18/25 (72%)
 Frame = +1

Query: 247 PTHTTPPPPPPPNPPLPPPPAPPSF 321
           P+ + PPPPPPP+PP  PPP  P F
Sbjct: 269 PSPSPPPPPPPPSPPPAPPPFVPGF 293

 Score = 40.0 bits (92), Expect = 0.016
 Identities = 15/26 (57%), Positives = 16/26 (60%)
 Frame = +1

Query: 247 PTHTTPPPPPPPNPPLPPPPAPPSFP 324
           P   +P PPPPP PP PPP  PP  P
Sbjct: 266 PPPPSPSPPPPPPPPSPPPAPPPFVP 291

 Score = 39.7 bits (91), Expect = 0.021
 Identities = 17/28 (60%), Positives = 18/28 (63%), Gaps = 3/28 (10%)
 Frame = +1

Query: 247 PTHTTPPP---PPPPNPPLPPPPAPPSF 321
           P+   PPP   PPPP PP  PPPAPP F
Sbjct: 262 PSPPPPPPSPSPPPPPPPPSPPPAPPPF 289

 Score = 38.9 bits (89), Expect = 0.035
 Identities = 16/33 (48%), Positives = 16/33 (48%)
 Frame = +1

Query: 226 CSCLAAIPTHTTPPPPPPPNPPLPPPPAPPSFP 324
           C C          PPPPPP PP P PP PP  P
Sbjct: 192 CDCCPQNIVVEPQPPPPPPPPPPPSPPPPPPPP 224

 Score = 38.5 bits (88), Expect = 0.046
 Identities = 21/53 (39%), Positives = 22/53 (40%)
 Frame = +1

Query: 247 PTHTTPPPPPPPNPPLPPPPAPPSFPLVACIIPSTNTHWQTHARNTQLPPPAP 405
           P    PPPP PP PP PPPP  P  P      PS           +  PPP P
Sbjct: 207 PPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPPP 259

 Score = 36.2 bits (82), Expect = 0.23
 Identities = 14/25 (56%), Positives = 14/25 (56%)
 Frame = +1

Query: 262 PPPPPPPNPPLPPPPAPPSFPLVAC 336
           PPPPPP  PP PPP  P  F    C
Sbjct: 275 PPPPPPSPPPAPPPFVPGFFDCELC 299

 Score = 33.1 bits (74), Expect = 1.9
 Identities = 12/14 (85%), Positives = 12/14 (85%)
 Frame = +1

Query: 262 PPPPPPPNPPLPPP 303
           PPPPPPP PPLP P
Sbjct: 431 PPPPPPPLPPLPFP 444

 Score = 32.0 bits (71), Expect(2) = 8e-08
 Identities = 16/38 (42%), Positives = 17/38 (44%)
 Frame = +3

Query: 384 PTSPSRPSICPRPSPRSPGSWRTAPRPPAPGSAAXTPP 497
           P SP  P   P PSP  P    + P PP P S    PP
Sbjct: 250 PPSPPPPPPPPSPSPPPPPPSPSPPPPPPPPSPPPAPP 287

 Score = 30.0 bits (66), Expect(2) = 3e-07
 Identities = 16/38 (42%), Positives = 16/38 (42%)
 Frame = +3

Query: 384 PTSPSRPSICPRPSPRSPGSWRTAPRPPAPGSAAXTPP 497
           P  P  PS  P P P  P S    P PP P S    PP
Sbjct: 221 PPPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPP 258

 Score = 28.5 bits (62), Expect(2) = 8e-07
 Identities = 16/38 (42%), Positives = 17/38 (44%)
 Frame = +3

Query: 384 PTSPSRPSICPRPSPRSPGSWRTAPRPPAPGSAAXTPP 497
           P  PS P   P P P SP      P PP P S +  PP
Sbjct: 236 PPPPSPPPPPPPPPPPSP------PPPPPPPSPSPPPP 267

 Score = 28.5 bits (62), Expect(2) = 2e-06
 Identities = 15/38 (39%), Positives = 15/38 (39%)
 Frame = +3

Query: 384 PTSPSRPSICPRPSPRSPGSWRTAPRPPAPGSAAXTPP 497
           P  P  PS  P P P SP      P PP P      PP
Sbjct: 254 PPPPPPPSPSPPPPPPSPSP---PPPPPPPSPPPAPPP 288

 Score = 28.1 bits (61), Expect(2) = 1e-05
 Identities = 15/38 (39%), Positives = 17/38 (44%)
 Frame = +3

Query: 384 PTSPSRPSICPRPSPRSPGSWRTAPRPPAPGSAAXTPP 497
           P  P  PS  P P P SP     +P PP P  +   PP
Sbjct: 245 PPPPPPPSPPPPPPPPSP-----SPPPPPPSPSPPPPP 277

 Score = 28.1 bits (61), Expect(2) = 5e-06
 Identities = 16/38 (42%), Positives = 17/38 (44%)
 Frame = +3

Query: 384 PTSPSRPSICPRPSPRSPGSWRTAPRPPAPGSAAXTPP 497
           P  PS P   P PSP SP     +P PP P      PP
Sbjct: 248 PPPPSPPPPPPPPSP-SPPPPPPSPSPPPPPPPPSPPP 284

 Score = 27.3 bits (59), Expect(2) = 2e-05
 Identities = 14/38 (36%), Positives = 17/38 (43%)
 Frame = +3

Query: 384 PTSPSRPSICPRPSPRSPGSWRTAPRPPAPGSAAXTPP 497
           P+ P  P   P PSP  P    +   PP P S +  PP
Sbjct: 239 PSPPPPPPPPPPPSPPPPPPPPSPSPPPPPPSPSPPPP 276

 Score = 26.9 bits (58), Expect(2) = 3e-05
 Identities = 15/38 (39%), Positives = 16/38 (41%)
 Frame = +3

Query: 384 PTSPSRPSICPRPSPRSPGSWRTAPRPPAPGSAAXTPP 497
           P  P  PS  P P P  P S    P PP P  +   PP
Sbjct: 233 PPPPPPPSPPPPPPPPPPPS----PPPPPPPPSPSPPP 266

 Score = 26.2 bits (56), Expect(2) = 5e-05
 Identities = 20/49 (40%), Positives = 21/49 (42%), Gaps = 11/49 (22%)
 Frame = +3

Query: 384 PTSPSRPSICPRPSPRSPG---SWRTAPRPPAPG--------SAAXTPP 497
           P SPS P   P PSP  P    S   AP P  PG        +A  TPP
Sbjct: 259 PPSPSPPPPPPSPSPPPPPPPPSPPPAPPPFVPGFFDCELCFAAELTPP 307



EST assemble image


clone accession position
1 CL29b09_r AV394665 1 610
2 LCL061c04_r AV629573 112 457




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research