KCC000435A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000435A_C01 KCC000435A_c01
tataaCTTGAACAATTAACTGAGTACTTTGAATGCCAATACAACACACCAAGTTCCAAAT
TCTGGAAGGCCGCGCTTCCGCACATCAAATGTCTTAGCAGAAACATAGTTGATATCAAAT
GGCTGAAGAACAGACCGCCCTGTCACTTAGCTGGGTCTTCGGGGCCTCGGCGCACGTAAA
GCATGGTGTAGTCAACTTGTCCGATGGCTACACGGACAAAATCTGCTATCTTGCGGCCAA
CACCGCGGTCATCTATGATAAACGTTTGAGGCGGCAATTGTTCTTACAGGGCCACACCAG
CCCCATCACATGCATCGTGACCACGGAGGACCGCTCGCATGTGGTCACTGCGGACACGGG
GCCGGAGGCGCTGCTGGTGGTGTGGAACGTGCGTACAGGGTTGCCCACGCGCACCGTGCA
GCAGCCGCACCGGCACGGCGTGTCCACCATGGACATGTCGGCGGACGGCCAGTGGCTGGC
CACCGTGAGCGCGGCTGACCCGGAGAGCGGCGAGCAGGAGGTGTCGCTGTGGTCCATG


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000435A_C01 KCC000435A_c01
         (538 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

gb|AAH36233.1| MGC33630 protein [Homo sapiens]                         87  1e-16
ref|NP_653269.1| hypothetical protein MGC33630 [Homo sapiens] gi...    87  1e-16
emb|CAD38786.1| hypothetical protein [Homo sapiens]                    87  1e-16
gb|EAA40825.1| GLP_154_14359_10013 [Giardia lamblia ATCC 50803]        77  1e-13
dbj|BAC34015.1| unnamed protein product [Mus musculus]                 62  4e-09

>gb|AAH36233.1| MGC33630 protein [Homo sapiens]
          Length = 946

 Score = 87.0 bits (214), Expect = 1e-16
 Identities = 45/133 (33%), Positives = 79/133 (58%), Gaps = 2/133 (1%)
 Frame = +2

Query: 140 LSLSWVFGASAHVKHGVVNLSDGYTDKICYLAANTAVIYDKRLRRQLFLQGHTSPITCIV 319
           L+++W FG ++ +   V  + +     + Y+ A+TA+IY+     Q  LQGH + I+C+ 
Sbjct: 254 LTMTWSFGWNSSLP--VYYIREERQRVLLYVCAHTAIIYNVFRNNQYHLQGHANIISCLC 311

Query: 320 TTEDRSHVVTADTGPEALLVVWNVRTGLPTRTV--QQPHRHGVSTMDMSADGQWLATVSA 493
            +EDR  + TAD GP+ L+++W+  TG+P  T+    P  +G+  M M+ D ++LAT+S 
Sbjct: 312 VSEDRRWIATADKGPDCLVIIWDSFTGIPVHTIFDSCPEGNGIMAMAMTHDAKYLATISD 371

Query: 494 ADPESGEQEVSLW 532
           A+     Q+V +W
Sbjct: 372 AE----VQKVCIW 380

>ref|NP_653269.1| hypothetical protein MGC33630 [Homo sapiens]
           gi|20306340|gb|AAH28421.1| Hypothetical protein MGC33630
           [Homo sapiens]
          Length = 1154

 Score = 87.0 bits (214), Expect = 1e-16
 Identities = 45/133 (33%), Positives = 79/133 (58%), Gaps = 2/133 (1%)
 Frame = +2

Query: 140 LSLSWVFGASAHVKHGVVNLSDGYTDKICYLAANTAVIYDKRLRRQLFLQGHTSPITCIV 319
           L+++W FG ++ +   V  + +     + Y+ A+TA+IY+     Q  LQGH + I+C+ 
Sbjct: 254 LTMTWSFGWNSSLP--VYYIREERQRVLLYVCAHTAIIYNVFRNNQYHLQGHANIISCLC 311

Query: 320 TTEDRSHVVTADTGPEALLVVWNVRTGLPTRTV--QQPHRHGVSTMDMSADGQWLATVSA 493
            +EDR  + TAD GP+ L+++W+  TG+P  T+    P  +G+  M M+ D ++LAT+S 
Sbjct: 312 VSEDRRWIATADKGPDCLVIIWDSFTGIPVHTIFDSCPEGNGIMAMAMTHDAKYLATISD 371

Query: 494 ADPESGEQEVSLW 532
           A+     Q+V +W
Sbjct: 372 AE----VQKVCIW 380

>emb|CAD38786.1| hypothetical protein [Homo sapiens]
          Length = 964

 Score = 87.0 bits (214), Expect = 1e-16
 Identities = 45/133 (33%), Positives = 79/133 (58%), Gaps = 2/133 (1%)
 Frame = +2

Query: 140 LSLSWVFGASAHVKHGVVNLSDGYTDKICYLAANTAVIYDKRLRRQLFLQGHTSPITCIV 319
           L+++W FG ++ +   V  + +     + Y+ A+TA+IY+     Q  LQGH + I+C+ 
Sbjct: 64  LTMTWSFGWNSSLP--VYYIREERQRVLLYVCAHTAIIYNVFRNNQYHLQGHANIISCLC 121

Query: 320 TTEDRSHVVTADTGPEALLVVWNVRTGLPTRTV--QQPHRHGVSTMDMSADGQWLATVSA 493
            +EDR  + TAD GP+ L+++W+  TG+P  T+    P  +G+  M M+ D ++LAT+S 
Sbjct: 122 VSEDRRWIATADKGPDCLVIIWDSFTGIPVHTIFDSCPEGNGIMAMAMTHDAKYLATISD 181

Query: 494 ADPESGEQEVSLW 532
           A+     Q+V +W
Sbjct: 182 AE----VQKVCIW 190

>gb|EAA40825.1| GLP_154_14359_10013 [Giardia lamblia ATCC 50803]
          Length = 1448

 Score = 77.4 bits (189), Expect = 1e-13
 Identities = 43/126 (34%), Positives = 72/126 (57%), Gaps = 1/126 (0%)
 Frame = +2

Query: 140 LSLSWVFGASAHVKHGVVNLSDGYTDKICYLAANTAVIYDKRLRRQLFLQGHTSPITCIV 319
           L++   FG +  +  GV +L D   + I + +++T V +D R   Q FLQGH++ I+ + 
Sbjct: 6   LNMKAAFGFNKDLMGGVHSLFDETREAILFPSSHTLVYHDCRNGSQRFLQGHSNMISAVC 65

Query: 320 TTEDRSHVVTAD-TGPEALLVVWNVRTGLPTRTVQQPHRHGVSTMDMSADGQWLATVSAA 496
            + D+  +V+AD  G + +++VW  +T LP RT+      GV  MD+S DG  LA +S A
Sbjct: 66  VSNDKRWIVSADFGGKDTMIIVWESKTLLPVRTIVDQVPGGVIRMDLSDDGALLAVLSGA 125

Query: 497 DPESGE 514
            P + +
Sbjct: 126 TPNAAK 131

>dbj|BAC34015.1| unnamed protein product [Mus musculus]
          Length = 657

 Score = 62.4 bits (150), Expect = 4e-09
 Identities = 33/116 (28%), Positives = 52/116 (44%)
 Frame = +2

Query: 140 LSLSWVFGASAHVKHGVVNLSDGYTDKICYLAANTAVIYDKRLRRQLFLQGHTSPITCIV 319
           L L WV+G   H     +  + G   ++ Y  A   V+Y+ R   Q F  GH   I  + 
Sbjct: 11  LRLEWVYGYRGHQCRNNLYYTAG--KEVVYFVAGVGVVYNTREHSQKFFLGHNDDIISLA 68

Query: 320 TTEDRSHVVTADTGPEALLVVWNVRTGLPTRTVQQPHRHGVSTMDMSADGQWLATV 487
              D++ + T   G E  + +WN         ++  H HGV+ +   +DGQ LA+V
Sbjct: 69  LHPDKTLIATGQVGKEPYICIWNSYNVHTVSILKDVHTHGVACLAFDSDGQHLASV 124



EST assemble image


clone accession position
1 HCL080a07_r AV644006 1 481
2 LCL078f07_r AV630424 6 451
3 CL52h12_r AV395850 8 538
4 CL68b10_r AV396931 14 495
5 CL29b07_r AV394640 30 519
6 HCL022b06_r AV640771 128 505




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research