KCC000433A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000433A_C01 KCC000433A_c01
CCTGCGCTCTTTTCACCACCGCACAAACTAAGTCCGCAACCTCTTGACCTTGATCCCCTA
CGTCACTAAACAAAAGCAACCAGTTGGTTAGAGCTCACCGAAAGGCTTGCCTGCGCGGTT
CGGAGGGAACTGTAGACAACCTGAGACGCTTATAAGTAGTTTCACAGCTTTCGGGGGCCT
TGACTGTTTGTGAGGGAGTGCATAGAGAAATGGAGCGGCAAGACTGTGCCGGCTCGAGCT
CGCAAGGGCCCCCGCAAGGCCGCGGAGGAACGCAGCCGCGCGGCATCAAGCAACTGCCTC
GGTTTGACGCGGGCGTGATGGAGACCTACTTGGACGACATGCGCGACATGAAGGCGAAGG
TGTACCAGATGTTCCGCGAGCACCCCGAGCTGCTGCCGAACGTGGAGGAGGGCCTGTCAA
AAGAGGAGCATCGCGAGCTAGTGCGCCGCTCGCTCAAGGTAATCCTGCAGGCCGGCTACA
GCCCTCTGGACTTCCTGGCTCGTGACCCGCGCAAGTACTTTTACCTGGGCGAGTGCTTGT
CCATGGTGGACCTGTCGCTCATG


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000433A_C01 KCC000433A_c01
         (563 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

gb|AAF14635.1|AF202987_1 acyl-CoA oxidase [Petroselinum crispum]       57  1e-07
ref|NP_201316.1| acyl-CoA oxidase (gb|AAC13497.1) [Arabidopsis t...    54  1e-06
pir||T52120 acyl-CoA oxidase (EC 1.3.3.6), peroxisomal [validate...    54  1e-06
pir||T07901 acyl CoA oxidase homolog - cucurbit gi|3115374|gb|AA...    53  2e-06
ref|XP_311129.1| ENSANGP00000004749 [Anopheles gambiae] gi|30178...    46  3e-04

>gb|AAF14635.1|AF202987_1 acyl-CoA oxidase [Petroselinum crispum]
          Length = 694

 Score = 57.4 bits (137), Expect = 1e-07
 Identities = 29/73 (39%), Positives = 46/73 (62%), Gaps = 1/73 (1%)
 Frame = +3

Query: 342 RDMKAKVYQMFREHPELLPNVEEGLSKEEHREL-VRRSLKVILQAGYSPLDFLARDPRKY 518
           RD++ KVY+ FR  P+L   +E  +S E+HREL +++ L ++ +AG  P  ++  DP  Y
Sbjct: 70  RDLQEKVYEFFRSRPDLQTPIE--ISTEKHRELCMKQLLALVREAGIKPFKYVVDDPFVY 127

Query: 519 FYLGECLSMVDLS 557
           F +GE    VD+S
Sbjct: 128 FAIGEAAGSVDVS 140

>ref|NP_201316.1| acyl-CoA oxidase (gb|AAC13497.1) [Arabidopsis thaliana]
           gi|10178173|dbj|BAB11647.1| acyl-CoA oxidase
           [Arabidopsis thaliana]
          Length = 692

 Score = 53.9 bits (128), Expect = 1e-06
 Identities = 27/73 (36%), Positives = 44/73 (59%), Gaps = 1/73 (1%)
 Frame = +3

Query: 345 DMKAKVYQMFREHPELLPNVEEGLSKEEHRELVRRSL-KVILQAGYSPLDFLARDPRKYF 521
           D++ K++  F   P+L   +E  +SK++HREL    L  ++ +AG  P  ++A DP KYF
Sbjct: 73  DIQEKIFDFFNSRPDLQTPIE--ISKDDHRELCMNQLIGLVREAGVRPFRYVADDPEKYF 130

Query: 522 YLGECLSMVDLSL 560
            + E +  VD+SL
Sbjct: 131 AIMEAVGSVDMSL 143

>pir||T52120 acyl-CoA oxidase (EC 1.3.3.6), peroxisomal [validated] -
           Arabidopsis thaliana gi|3044212|gb|AAC13497.1| acyl-CoA
           oxidase [Arabidopsis thaliana]
          Length = 692

 Score = 53.9 bits (128), Expect = 1e-06
 Identities = 27/73 (36%), Positives = 44/73 (59%), Gaps = 1/73 (1%)
 Frame = +3

Query: 345 DMKAKVYQMFREHPELLPNVEEGLSKEEHRELVRRSL-KVILQAGYSPLDFLARDPRKYF 521
           D++ K++  F   P+L   +E  +SK++HREL    L  ++ +AG  P  ++A DP KYF
Sbjct: 73  DIQEKIFDFFNSRPDLQTPIE--ISKDDHRELCMNQLIGLVREAGVRPFRYVADDPEKYF 130

Query: 522 YLGECLSMVDLSL 560
            + E +  VD+SL
Sbjct: 131 AIMEAVGSVDMSL 143

>pir||T07901 acyl CoA oxidase homolog - cucurbit gi|3115374|gb|AAC15870.1| acyl
           CoA oxidase homolog [Cucurbita sp. cv. Kurokawa Amakuri]
          Length = 690

 Score = 53.1 bits (126), Expect = 2e-06
 Identities = 31/87 (35%), Positives = 49/87 (55%), Gaps = 2/87 (2%)
 Frame = +3

Query: 306 DAGVMETYLDDM-RDMKAKVYQMFREHPELLPNVEEGLSKEEHRELVRRSLK-VILQAGY 479
           D G +  Y+    R+++ +V++ F   PEL   V  G+S  +HREL  + L  ++ +AG 
Sbjct: 57  DMGSLSLYMRGKHREIQERVFEYFNSRPELQTPV--GISMADHRELCMKQLVGLVREAGI 114

Query: 480 SPLDFLARDPRKYFYLGECLSMVDLSL 560
            P  F+  DP KYF + E +  VD+SL
Sbjct: 115 RPFRFVNEDPAKYFAIMEAVGSVDVSL 141

>ref|XP_311129.1| ENSANGP00000004749 [Anopheles gambiae] gi|30178092|gb|EAA06612.2|
           ENSANGP00000004749 [Anopheles gambiae str. PEST]
          Length = 633

 Score = 46.2 bits (108), Expect = 3e-04
 Identities = 32/89 (35%), Positives = 40/89 (43%), Gaps = 3/89 (3%)
 Frame = -3

Query: 558 ATGPPWTSTRPGKSTCAGHEPGSPEGCSRPAGLP*ASGALARDAPLLTGPPPRSAAARGA 379
           A   P + +    S C G  P S    +RPAG P A  A A      + PP RS+A    
Sbjct: 526 AAACPTSPSAARPSGCPGRSPPSAPPAARPAGPPAACTARAPPGRSRSAPPSRSSAGPAV 585

Query: 378 RGTSGTP---SPSCRACRPSRSPSRPRQT 301
               G+P   S SC A RP  SP+ PR +
Sbjct: 586 ASGCGSPPDCSASC-AARPPASPAAPRSS 613



EST assemble image


clone accession position
1 CL29b04_r AV394674 1 605
2 CL52h02_r AV395856 88 580
3 LCL051h11_r AV629095 107 546
4 MXL060h05_r BP096566 114 465
5 HCL049g09_r AV642328 115 575
6 HCL033h12_r AV641454 115 554
7 HCL048e08_r AV642259 115 394
8 MXL097e04_r BP098692 116 494
9 LCL099f04_r AV631775 117 540
10 LCL076c09_r AV630263 118 546
11 MXL057g07_r BP096376 125 535
12 HCL009b02_r AV640029 127 661
13 MXL091d01_r BP098314 128 264
14 LCL078g09_r AV630435 134 475
15 LCL048c04_r AV628869 222 537
16 LCL016c02_r AV626832 247 662




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research