KCC000432A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000432A_C01 KCC000432A_c01
CACGAAAGTGTCGCCACCTCTTAATCTTGTTTAGCTACAAAAGCTGCAGCTCGACCCTCT
AGCCGCTGTCCTCAAAGCCCACGAATTTCAGGCACTTGCACAGATACTTGCTCTGTAAAG
GCTTTGCCGGGGTCGTGACCTTCAAGCTTTCCCCCCCGGCATTTTGCTAGCGACTGGAGC
CGTTCTCTCGGCATACCTGGCAGCTCCCTCGGATAGCAGTTCAGACTAGCAGCACAGCAT
GCGGTCGTAGGGGCGCATCTGCGCGCCCGCGCCTTGCCGGGAGAGGCGAGCTGGGCAAGC
GCACTCGGCCTGACCTTCACCAGCTAACATGATTGTCGAGGCACAATACTTGCTACAAGT
TTACGGAGCTATCAAAAATGACTGCCGTGGCAGCGAAGACCAGGCTGTTATGTGCTTCGC
TGCCTGCACGGATGCCGACTCGGTTTGCGCGTCACAGCAGCTCATGAACCTGTTCAACCG
GGAGGGCATCTTCTTCACGCT


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000432A_C01 KCC000432A_c01
         (501 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

gb|AAP54042.1| putative mutator protein [Oryza sativa (japonica ...    35  0.40
ref|NP_571533.1| insulin-like growth factor binding protein 2 [D...    35  0.67
ref|NP_034457.1| glycoprotein Ib, beta polypeptide [Mus musculus...    27  1.2
gb|AAD55090.1| thaumatin [Vitis riparia]                               32  3.3
dbj|BAC82921.1| hypothetical protein [Oryza sativa (japonica cul...    32  5.7

>gb|AAP54042.1| putative mutator protein [Oryza sativa (japonica cultivar-group)]
          Length = 929

 Score = 35.4 bits (80), Expect = 0.40
 Identities = 22/73 (30%), Positives = 34/73 (46%), Gaps = 8/73 (10%)
 Frame = -3

Query: 310  GRVRLPSSPLPARRGRADAPLRPHAVLLV*TAIRGSCQVCRENGSSR*--------QNAG 155
            G +++P  P   RR  A  P +P       T +R  C+ C++ G ++         Q AG
Sbjct: 796  GYIKMPGRPRTERRREAHEPAKPSKASKFGTKVR--CRTCKQVGHNKSSCHKHNPAQTAG 853

Query: 154  GESLKVTTPAKPL 116
            G S +V TP+  L
Sbjct: 854  GSSQQVATPSHNL 866

>ref|NP_571533.1| insulin-like growth factor binding protein 2 [Danio rerio]
           gi|6671182|gb|AAF23123.1|AF198033_1 insulin-like growth
           factor binding protein-2 [Danio rerio]
           gi|33604152|gb|AAH56331.1| Unknown (protein for
           MGC:65741) [Danio rerio]
          Length = 276

 Score = 34.7 bits (78), Expect = 0.67
 Identities = 20/64 (31%), Positives = 32/64 (49%), Gaps = 1/64 (1%)
 Frame = -2

Query: 275 KARARRCAPTTACCAASLNCYPRELPGMPRERL-QSLAKCRGGKLEGHDPGKAFTEQVSV 99
           +    +C   T  C++ L CYP+    +P E L Q L +C G K++    G A   +VS 
Sbjct: 63  RQEGEQCGVYTPRCSSGLRCYPKPDSELPLELLVQGLGRC-GRKVDTEPTGSAEPREVSG 121

Query: 98  QVPE 87
           +V +
Sbjct: 122 EVQD 125

>ref|NP_034457.1| glycoprotein Ib, beta polypeptide [Mus musculus]
           gi|3023891|sp|P56400|GPBB_MOUSE Platelet glycoprotein Ib
           beta chain precursor (GP-Ib beta) (GPIbB) (GPIb-beta)
           gi|2443352|dbj|BAA22424.1| platelet glycoprotein Ib beta
           [Mus musculus]
          Length = 206

 Score = 26.9 bits (58), Expect(2) = 1.2
 Identities = 15/37 (40%), Positives = 21/37 (56%), Gaps = 1/37 (2%)
 Frame = +1

Query: 49  ARPSSRCPQSPRISGTCTDTCSVKALP-GS*PSSFPP 156
           +RP+S CP     +GT  D C  + L   S P++FPP
Sbjct: 20  SRPASGCPAPCSCAGTLVD-CGRRGLTWASLPAAFPP 55

 Score = 25.8 bits (55), Expect(2) = 1.2
 Identities = 12/25 (48%), Positives = 17/25 (68%)
 Frame = +2

Query: 131 GRDLQAFPPGILLATGAVLSAYLAA 205
           G +L A PPG+L A  A+ +A+L A
Sbjct: 64  GNNLTALPPGLLDALPALRAAHLGA 88

>gb|AAD55090.1| thaumatin [Vitis riparia]
          Length = 247

 Score = 32.3 bits (72), Expect = 3.3
 Identities = 14/38 (36%), Positives = 20/38 (51%)
 Frame = +1

Query: 16  TS*SCLATKAAARPSSRCPQSPRISGTCTDTCSVKALP 129
           TS  C   K  A  + +CPQ+ + SG C + C+V   P
Sbjct: 140 TSGGCRGIKCTANINGQCPQALKASGGCNNPCTVFKTP 177

>dbj|BAC82921.1| hypothetical protein [Oryza sativa (japonica cultivar-group)]
          Length = 170

 Score = 31.6 bits (70), Expect = 5.7
 Identities = 30/98 (30%), Positives = 38/98 (38%), Gaps = 1/98 (1%)
 Frame = -2

Query: 344 VPRQSC*LVKVRPSALAQLASPGKARARRCAPTTACCAASLNCYPRELPGMPRERLQSLA 165
           V +Q C L+ V    +A+L  PG   AR     TA C    +             L S+A
Sbjct: 67  VAKQPCCLMHVLHGDVARLVGPGFDTARAMVNVTAACLGDASV------------LMSIA 114

Query: 164 K-CRGGKLEGHDPGKAFTEQVSVQVPEIRGL*GQRLEG 54
           + C G  L    P   FT  V    P+  G    RLEG
Sbjct: 115 RSCAGKPLPPLTPEYPFTTGVPPAPPQTSG--ATRLEG 150



EST assemble image


clone accession position
1 CL29a03_r AV394634 1 592
2 MXL068g08_r BP097019 50 475
3 LCL059d08_r AV629473 68 497




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research