KCC000431A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000431A_C01 KCC000431A_c01
gcagccagcacgcaacaaaacttacttactttGTGCCGCTGGCAGCATTGCAGTGATAGG
GCTCACGGTCTTGGGGGCACAAACACGAAATCCTGGCCCTCGCCAGGACTCCCAAACTCG
TGATCCTTCAATCCTTAAATCGCTCGACGCTGAGGCTTCCCGCACTACCAACACTTACTG
GCAACTTCCTATCCGCGAAGAAGACGACCATCATCGCAAGCACAACATCCGCTGACTTCC
GCGCTTTCTCTGCAAGCTCTGACCGCGGCACCCGCTCGCTATTCAACAGCAAGCAACTTC
CCTCAACCACTGCTCCAGAGGCGAAGCCAGCAACACAGGCGTCAGGCTCAGCGGCCGAGA
TGGCGCGCTTCCCCTACACCACCCTGCGCATCTTCCAGCAGGGCGCGCAGGCGGTGGTGC
AGCCTGTGCCTGAGGGCAATGCGTCGTCCGTGGAGACGCTGGTGGTGGACCTGGCGAACG
GGAAGTCCACGGTGACGCCGAG


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000431A_C01 KCC000431A_c01
         (502 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

dbj|BAC04807.1| unnamed protein product [Homo sapiens]                 40  0.016
ref|ZP_00123977.1| COG0810: Periplasmic protein TonB, links inne...    38  0.061
ref|NP_644123.1| conserved hypothetical protein [Xanthomonas axo...    37  0.10
ref|NP_792293.1| tonB protein [Pseudomonas syringae pv. tomato s...    37  0.10
ref|XP_327059.1| predicted protein [Neurospora crassa] gi|183760...    37  0.10

>dbj|BAC04807.1| unnamed protein product [Homo sapiens]
          Length = 123

 Score = 40.0 bits (92), Expect = 0.016
 Identities = 26/80 (32%), Positives = 35/80 (43%), Gaps = 6/80 (7%)
 Frame = +1

Query: 259 LTAAPARYSTASNFPQPLLQRRSQQHRRQAQRPRWRASPTPPCASSSRARRRWCSLCLRA 438
           L  APA+ ++ S  P P+ Q++S+   R+A          PP A   R   R C  C   
Sbjct: 36  LQMAPAKATSHSPLPSPVTQQQSRGSSREALH-------VPPKAGLPRLHGRVCIFCCCD 88

Query: 439 MRRP------WRRWWWTWRT 480
           +RRP        RWW  W T
Sbjct: 89  LRRPLSEAGATTRWWDEWVT 108

>ref|ZP_00123977.1| COG0810: Periplasmic protein TonB, links inner and outer membranes
           [Pseudomonas syringae pv. syringae B728a]
          Length = 277

 Score = 38.1 bits (87), Expect = 0.061
 Identities = 19/42 (45%), Positives = 21/42 (49%), Gaps = 1/42 (2%)
 Frame = -2

Query: 474 PGPP-PASPRTTHCPQAQAAPPPARPAGRCAGWCRGSAPSRP 352
           P PP PA+P     P A  AP P  PA   AG+ R  AP  P
Sbjct: 162 PAPPVPAAPVAAPAPPAAPAPKPVTPASASAGYLRNPAPEYP 203

>ref|NP_644123.1| conserved hypothetical protein [Xanthomonas axonopodis pv. citri
           str. 306] gi|21110214|gb|AAM38659.1| conserved
           hypothetical protein [Xanthomonas axonopodis pv. citri
           str. 306]
          Length = 347

 Score = 37.4 bits (85), Expect = 0.10
 Identities = 30/119 (25%), Positives = 44/119 (36%), Gaps = 15/119 (12%)
 Frame = +1

Query: 166 YQHLLATSYPRRR--RPSSQAQHPLTSALSLQALTAAPARYSTASNFPQPLLQRRSQQHR 339
           Y+ LLA + PR     P +QA   L  A  ++    +PA+ +         L     Q  
Sbjct: 127 YRQLLARACPRDAAGNPDAQAWRALAEAAQVELRDLSPAQLTRLGQLRDSALAGMPLQAA 186

Query: 340 RQAQRPRWRASPTPPCASSSRARRRW-------------CSLCLRAMRRPWRRWWWTWR 477
             A       +P  P A+ +RARR+W               +   A+      WWWT R
Sbjct: 187 APAAPAEPAPAPRRPAAARARARRQWQWPQLERRHAGVALGVLAVALLLAVLGWWWTHR 245

>ref|NP_792293.1| tonB protein [Pseudomonas syringae pv. tomato str. DC3000]
           gi|28852916|gb|AAO55988.1| tonB protein [Pseudomonas
           syringae pv. tomato str. DC3000]
          Length = 273

 Score = 37.4 bits (85), Expect = 0.10
 Identities = 19/42 (45%), Positives = 20/42 (47%), Gaps = 1/42 (2%)
 Frame = -2

Query: 474 PGPP-PASPRTTHCPQAQAAPPPARPAGRCAGWCRGSAPSRP 352
           P PP PA P     P A  AP P  PA   AG+ R  AP  P
Sbjct: 158 PAPPVPAPPVAAPAPPAPPAPKPVTPASASAGYLRNPAPEYP 199

>ref|XP_327059.1| predicted protein [Neurospora crassa] gi|18376018|emb|CAB91752.2|
           related to pre-mRNA splicing SRp75 [Neurospora crassa]
           gi|28925300|gb|EAA34378.1| predicted protein [Neurospora
           crassa]
          Length = 462

 Score = 37.4 bits (85), Expect = 0.10
 Identities = 29/89 (32%), Positives = 42/89 (46%), Gaps = 4/89 (4%)
 Frame = +1

Query: 169 QHLLATSYPRRRRPS--SQAQHPLTSALSLQALTAAPARYST--ASNFPQPLLQRRSQQH 336
           Q L  T   R R PS  S+    L+ + S      A + Y+T   S++P+   +RRS   
Sbjct: 175 QALAVTDARRARSPSRDSRISRGLSRSRSRSRSRGARSIYTTDDESDYPRSSRRRRSPSS 234

Query: 337 RRQAQRPRWRASPTPPCASSSRARRRWCS 423
           RR   R R R SP+P  A   +A+  + S
Sbjct: 235 RRSRSRSRSRRSPSPAAAPLRKAKDLYSS 263



EST assemble image


clone accession position
1 MXL071e05_r BP097188 1 372
2 LCL068d11_r AV629892 33 434
3 LCL022e01_r AV627191 40 300
4 LCL068b01_r AV629875 41 396
5 CL28h07_r AV394789 50 503
6 LCL092a08_r AV631327 61 187
7 HCL005g01_r AV639830 61 487




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research