KCC000430A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000430A_C01 KCC000430A_c01
CTACACAAAAAGTAGAGGGCGTCTGTCACTCAGTCACCGCTCCACTGCACGCATAAATGT
TTTTGCTGAAGGCCTAGAATGTTTGTATGTTGTTTAGGCCCGCACACCCTACCGAGCTCG
CCTGATGAGGGCACTCGGGTTAAGCGTAAGAGCTTAGATGTGGCAGCAACCGAGGAGTCC
GAACGCGTCCCCGGAAAGGCCGCATCCACAGCCCACGGCAACAATGGCTATAAAAAGCTG
CAAATGTATGAGGGCCTTCTGCCTGGGCAGCTGCCTGACTCTCCTCGTGACGCTGAGGGC
TTGGCCAGTATCCTCGAGGGCCCCGCAAAGGGCAGCGCGGTGTCGCTCTTAGAGGACGGG
TTAGCAAACGATGGGCGCGGGAAGTCGTTCTTCGCGGCGTCATGCGCCCACGCAACTGCC
GGGGGCAACGGGCAGCTGGCGCTAGTCGTGCCGCCCCACCTCCTCCCAGCGGACGCGGCG
GCCTTTGACACCGACTTCCGCGGTGGCGAGCAGGTGACTGCTTTGCCCTCAGTCAGCAGC
A


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000430A_C01 KCC000430A_c01
         (541 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

pir||C72641 hypothetical protein APE0563 - Aeropyrum pernix (str...    42  0.004
dbj|BAC15858.1| hypothetical protein [Oryza sativa (japonica cul...    39  0.034
ref|NP_115763.2| protein kinase, lysine deficient 4; putative pr...    39  0.057
emb|CAC48387.1| serine/threonine protein kinase [Homo sapiens]         39  0.057
ref|ZP_00088552.1| COG0019: Diaminopimelate decarboxylase [Azoto...    38  0.075

>pir||C72641 hypothetical protein APE0563 - Aeropyrum pernix (strain K1)
           gi|5104216|dbj|BAA79531.1| 166aa long hypothetical
           protein [Aeropyrum pernix]
          Length = 166

 Score = 42.4 bits (98), Expect = 0.004
 Identities = 36/117 (30%), Positives = 42/117 (35%), Gaps = 25/117 (21%)
 Frame = -1

Query: 523 KQSPARHRGSRCQRPPR---------PLGGGGAARLAPAARCPRQLRGRMTPRRTTSRAH 371
           + +P    G RC+ P R         PL GGG     P  R PR L    TP       H
Sbjct: 43  RPAPEERVGQRCEHPRRHAPSCCHHAPLEGGGVYHQCPGPRGPRSLHHH-TPSGGARHRH 101

Query: 370 ----RLLTRPLRATPR------CPLRGPRGYW------PSPQRHEESQAAAQAEGPH 248
                L  +PL A         C L GP   +      PSP R    Q +  A GPH
Sbjct: 102 DYGLALSRQPLEAAEAQPPVLGCRLSGPLPVYVVEADRPSPGRRSPGQGSGHAPGPH 158

>dbj|BAC15858.1| hypothetical protein [Oryza sativa (japonica cultivar-group)]
           gi|22831254|dbj|BAC16111.1| hypothetical protein [Oryza
           sativa (japonica cultivar-group)]
          Length = 174

 Score = 39.3 bits (90), Expect = 0.034
 Identities = 39/116 (33%), Positives = 50/116 (42%), Gaps = 13/116 (11%)
 Frame = -3

Query: 506 PPRKSVSKAAASAGRRWGGTTSASCPL---PPAVAWAHDAAKNDFPRPSFAN----PSSK 348
           PPR++ ++  +S GR        + PL   PP+ A    AA    P P  A     P   
Sbjct: 39  PPRQAAARRLSSPGR-------LAPPLLAGPPSAASPCQAAARRLPPPRAAKHRLPPRRA 91

Query: 347 SDTALP---FAGP---SRILAKPSASRGESGSCPGRRPSYICSFL*PLLPWAVDAA 198
           +D  LP    AGP   + +LA+P   R    S PGRR S       PLL W   AA
Sbjct: 92  TDRRLPPRPAAGPPTAASLLARPPGRRALPPSSPGRRAS-------PLLAWPPRAA 140

>ref|NP_115763.2| protein kinase, lysine deficient 4; putative protein kinase WNK4
           [Homo sapiens] gi|15212448|gb|AAK91995.1|AF390018_1
           putative protein kinase WNK4 [Homo sapiens]
          Length = 1243

 Score = 38.5 bits (88), Expect = 0.057
 Identities = 31/92 (33%), Positives = 37/92 (39%), Gaps = 9/92 (9%)
 Frame = -1

Query: 484 RPPRPLGGGGAARLAPAARCPRQLRGRMTPRRTTSRAHR--------LLTRPLRATPR-C 332
           RPP PLG  G  RL P  R  R+  G+  PR  +SR  R        L +  L A+P   
Sbjct: 23  RPPPPLGTAGQPRLGPPPRRARRFSGKAEPRPRSSRLSRRSSVDLGLLSSWSLPASPAPD 82

Query: 331 PLRGPRGYWPSPQRHEESQAAAQAEGPHTFAA 236
           P   P    P P R     +    EG  T  A
Sbjct: 83  PPDPPDSAGPGPARSPPPSSKEPPEGTWTEGA 114

>emb|CAC48387.1| serine/threonine protein kinase [Homo sapiens]
          Length = 1231

 Score = 38.5 bits (88), Expect = 0.057
 Identities = 31/92 (33%), Positives = 37/92 (39%), Gaps = 9/92 (9%)
 Frame = -1

Query: 484 RPPRPLGGGGAARLAPAARCPRQLRGRMTPRRTTSRAHR--------LLTRPLRATPR-C 332
           RPP PLG  G  RL P  R  R+  G+  PR  +SR  R        L +  L A+P   
Sbjct: 11  RPPPPLGTAGQPRLGPPPRRARRFSGKAEPRPRSSRLSRRSSVDLGLLSSWSLPASPAPD 70

Query: 331 PLRGPRGYWPSPQRHEESQAAAQAEGPHTFAA 236
           P   P    P P R     +    EG  T  A
Sbjct: 71  PPDPPDSAGPGPARSPPPSSKEPPEGTWTEGA 102

>ref|ZP_00088552.1| COG0019: Diaminopimelate decarboxylase [Azotobacter vinelandii]
          Length = 1027

 Score = 38.1 bits (87), Expect = 0.075
 Identities = 33/94 (35%), Positives = 39/94 (41%), Gaps = 9/94 (9%)
 Frame = -1

Query: 514 PARHRGSRCQRPPRPLGGGGAARLAPAARCPRQLRGRMTPRRTTS--RAHRLLTRPLRAT 341
           PAR   +R  R P        A L   AR  RQ  G + PR+     R HR+L  PL A 
Sbjct: 354 PARSADARTDRQP--------AGLRADARAGRQHSGPVRPRQRGGGPRGHRVLRHPLPAE 405

Query: 340 PRC------PLRGPRG-YWPSPQRHEESQAAAQA 260
           PRC      P  G  G     P RH+    A +A
Sbjct: 406 PRCGQPRALPATGRHGPVHLDPGRHQRLPGAGRA 439



EST assemble image


clone accession position
1 CL28g10_r AV394813 1 630
2 LCL016h04_r AV626862 61 566
3 LCL049a03_r AV628918 77 339
4 HCL032h04_r AV641397 82 470




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research