KCC000429A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000429A_C01 KCC000429A_c01
CCGAGTCCTCGGCATCGCCCGACCGACGCTTTTACGACGGAAACGCTGCACCTGTCAATA
GAAACTCTCGTCACTCGCGTACACCAGCTGCCCAGTGCCTTGGTAAAGCTCCATGTACCA
AACCATCGCTGGCTCTTGAGGACCTCGCGCTCGCCGGCTCCCTAGCCGCATCCTTAGGTA
CACGTCTCTGATGCTGTGTCCCATATCCCAGCGGGCGTGAATCGGAGTGTCAAGGGAAAC
GCTGAGCACACGTGCTTGCCGCCTGGCACGCTCGCTGGCAGTGCCGTCTGCTGCAACTAG
GATGAGTCCACGCAGTACCTCAGTGGGGTCTCTGGCGGCTGCTTTATTGCTATGGACTGG
CATCGCGACTGGGGCAAATTTGCCCACTTTCAGCTCGCTGGAGGACGCGACGCTTGTGCA
CAGGACCTGCCAGACGATACAGAAAGGAACCCAAGCGGTGCAGGGATGCGTGCTGCGAGG
AAACGGGAAATGGCAAGTTGCGCTTGGCGCGACTGAAGGATCGGATTGTGCAGCGACTGG
AACCTTTATCGACTCGTCTCAGACAACAAGCAATTTCGGTAAGCTGCGTGTGGT


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000429A_C01 KCC000429A_c01
         (594 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

emb|CAD40737.1| OSJNBa0072D21.11 [Oryza sativa (japonica cultiva...    35  0.60
ref|ZP_00008541.1| COG0410: ABC-type branched-chain amino acid t...    33  3.0
sp|P25792|CYSP_SCHMA Cathepsin B-like cysteine proteinase precur...    33  3.0
emb|CAD44624.1| cathepsin B1 isotype 1 [Schistosoma mansoni]           33  3.0
ref|ZP_00016046.1| hypothetical protein [Rhodospirillum rubrum]        33  3.0

>emb|CAD40737.1| OSJNBa0072D21.11 [Oryza sativa (japonica cultivar-group)]
          Length = 383

 Score = 35.4 bits (80), Expect = 0.60
 Identities = 36/127 (28%), Positives = 47/127 (36%), Gaps = 5/127 (3%)
 Frame = +1

Query: 121 NHRWLLRTSRSPAP*PHP*VHVSDAVSHIPAGVNRSVKGNAEHTCLPPGTLAGSAVCCN* 300
           +H  LL+ S  P P P P  H+  + S   AGV   V G+     +  G L G  V  + 
Sbjct: 3   HHHLLLQLSPPPPPPPLPAAHLMMSPSFFDAGVFADVGGDWMEDLMHLGELFGVGVGGDD 62

Query: 301 DESTQYLSGVSGGCFIAMDWHRDW---GKFAHFQLAGGRDACAQD--LPDDTERNPSGAG 465
           D++     GV GG     +W  +    G   H    G  D        P D E       
Sbjct: 63  DDNGGVDGGVGGGDDRMQEWQNNCEGAGSPDHQPSCGDGDGDGDGDVSPRDGELGDGDGD 122

Query: 466 MRAARKR 486
             A RKR
Sbjct: 123 NSATRKR 129

>ref|ZP_00008541.1| COG0410: ABC-type branched-chain amino acid transport systems,
           ATPase component [Rhodopseudomonas palustris]
          Length = 374

 Score = 33.1 bits (74), Expect = 3.0
 Identities = 27/80 (33%), Positives = 35/80 (43%), Gaps = 2/80 (2%)
 Frame = -3

Query: 343 SSRQRPH*GT--AWTHPSCSRRHCQRACQAASTCAQRFP*HSDSRPLGYGTQHQRRVPKD 170
           S+++RPH G   A  HP   R      C+A    A+R    S SR    G+ H RR    
Sbjct: 22  SAQRRPHHGVGPAVRHPEARRAGACARCRAEDPAARRTGRRSQSR----GSLHPRRPDPP 77

Query: 169 AAREPASARSSRASDGLVHG 110
            +R P   R  RA+    HG
Sbjct: 78  HSRRP---RHHRAAGRAPHG 94

>sp|P25792|CYSP_SCHMA Cathepsin B-like cysteine proteinase precursor (Antigen Sm31)
           gi|160950|gb|AAA29865.1| cathepsin B
          Length = 340

 Score = 33.1 bits (74), Expect = 3.0
 Identities = 11/25 (44%), Positives = 17/25 (68%)
 Frame = +1

Query: 346 IAMDWHRDWGKFAHFQLAGGRDACA 420
           IA  W+ DWG+  +F++  GRD C+
Sbjct: 305 IANSWNEDWGENGYFRIVRGRDECS 329

>emb|CAD44624.1| cathepsin B1 isotype 1 [Schistosoma mansoni]
          Length = 340

 Score = 33.1 bits (74), Expect = 3.0
 Identities = 11/25 (44%), Positives = 17/25 (68%)
 Frame = +1

Query: 346 IAMDWHRDWGKFAHFQLAGGRDACA 420
           IA  W+ DWG+  +F++  GRD C+
Sbjct: 305 IANSWNEDWGENGYFRIVRGRDECS 329

>ref|ZP_00016046.1| hypothetical protein [Rhodospirillum rubrum]
          Length = 552

 Score = 33.1 bits (74), Expect = 3.0
 Identities = 17/31 (54%), Positives = 18/31 (57%)
 Frame = +3

Query: 96  CLGKAPCTKPSLALEDLALAGSLAASLGTRL 188
           CLG A C  P   +ED A AGS AA L T L
Sbjct: 35  CLGLAACQSPGGQMEDAAQAGSPAAGLSTDL 65



EST assemble image


clone accession position
1 LCL032b03_r AV627791 1 299
2 LCL024g01_r AV627306 1 324
3 LCL100a10_r AV631801 1 428
4 LCL027c06_r AV627473 10 335
5 LCL048g06_r AV628905 15 322
6 CL28f02_r AV394795 34 516
7 LCL061h05_r AV629606 34 506
8 HCL032e04_r AV641373 38 414
9 HCL067c10_r AV643306 56 524
10 LCL072h08_r AV630090 109 594
11 LCL100g09_r AV631849 110 553
12 LCL064b10_r AV629709 115 558




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research