KCC000428A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000428A_C01 KCC000428A_c01
acgaggcaccggcgcccgtgtcgccgtttgcggcggctgcggccgccgccggggcCTCCA
GCGGCATGGCTGCCGGCCGGCTGCTGCGCACCGCCCGCTGCGGCGCGCAGGCGCTGCTGC
GCGACTCGGCGCCGGCCTCCGGCGCGGGCGCCATGATGTCGCGCGAGGTGACCAAGGTGT
TTTGCAACACGCGACAGCTGGTGTACGCGGCGGGCGACCAGGTGGAGGTGCGGGTGGAGG
ACCCGCACAAGGCGCAGGAGGACCTGAGCGCCGCCTGCCGCATGGCGGTGCTGCAGCGCC
TGTCGCTCGCCGGCCAGGCCTCCACCGGCCACGTCCGCGTCGCGTAAAAGGAGGCGAGAG
CCCTGCTCAACGGCTACTCCTACATGGGCCAAGTGTGCAGTGTTCGGCCTGTACCAGGCG
GCATCATTCGCGGCGTGCCAAGAGCTTGCAGTTCCCAGGCGCACGAGGGCCCTGGTTGTA
CTTCGCTGCACATACGGTAACATCGGTGTGTGTACGCTGCGCCCGCGACTGTACCGCGGT
CGGACTCCGGTACGCGGCGGTTCGTGGTGCGCTTGTAGTCTAAGTTCCAGCAACACCATC
GCTGGAGGTGACAGACGGTAAACCGTTCTTGACCCAAAGCGGCGGACGATCTCGGGCGCC
GCGTGTATTTTGAGCGTGCCCCTTTCCCGAGAACATAGGGGTTTCGTGGCCATGTTCATG
GCTTTTTTTGCACACAAACGCCTAAAAAACATAGCGGTTGAGCCTTTTTAGGGTTGCGCG
GTGCACGGCATTCTACAATCCCAGAATGCATGGTTGTTCGTTGGTTGATAGCAGGTGACG
CGGCTATACTGTTATGCGCGTCTGACCCAGATCCCGGCAAGCCCACGCGCTCCGCTTTGG
TGATGTCGCTGTCAGTTTGACAGAGGAGACGCAGTTGCGCAAGGATCATGGGTGAAAACC
CAGTTGTGGTACTTTTGAATAGGTATCGTTGCTATGAATTTTGAAGATGTTCGTGCGCGT
TGCAATGGCGAGGCACGCATGCAGAGCTAGCTCGGAATTGAGACTGAGAAGATCTAGAGA
TGAAGCAGCAGCAGAGCATTAAAACCCTCGTCAAGCCTCGGCGGCGGTTTCGTTCTTTCC
CAGGGCTCTCGCACAGCCCGGCATGCAGACTCGCCCCCTTGGCCGAGATGAGGGCGAAGA
GGATGGAGAGGGACTGAGGTTGCAGTGCGAAAAGGGTAGCGCGGTTTGCGGTTTTCTGGG


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000428A_C01 KCC000428A_c01
         (1260 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|NP_492875.2| pre-mRNA splicing SR protein related (68.2 kD) ...    59  1e-07
dbj|BAC83819.1| hypothetical protein [Oryza sativa (japonica cul...    56  2e-06
ref|NP_862421.1| putative hydroxyproline-rich protein [Micrococc...    56  2e-06
ref|XP_233556.2| similar to Ser/Arg-related nuclear matrix prote...    56  2e-06
gb|AAK61383.1| basic proline-rich protein [Sus scrofa]                 55  2e-06

>ref|NP_492875.2| pre-mRNA splicing SR protein related (68.2 kD) (rsr-1)
           [Caenorhabditis elegans] gi|19571645|emb|CAB04214.3| C.
           elegans RSR-1 protein (corresponding sequence F28D9.1)
           [Caenorhabditis elegans]
          Length = 601

 Score = 59.3 bits (142), Expect = 1e-07
 Identities = 51/149 (34%), Positives = 65/149 (43%), Gaps = 25/149 (16%)
 Frame = -1

Query: 381 RSSR*AGLSPPFTRRGRGRWR-----PGRRATGAAAPPCGRRRSGPPAPCAGPPPAP--- 226
           R S  A  SPP  RR R   +     P R  + + +PP   RR   P+    PPPAP   
Sbjct: 305 RRSPSASKSPPPARRRRSPSQSKSPAPKRAKSRSKSPPAPARRRRSPSASKSPPPAPKRA 364

Query: 225 ------PPGRPPRTPAVACCKTPWSPRAT-SWRPRRRPAPSRAAAPARRSGRCAAAGRQP 67
                 PP R  R+P+ +  K+P +PR   S    R PAP R   PARR    +A+   P
Sbjct: 365 KSRSKSPPARRRRSPSAS--KSPPAPRRRRSPSKSRSPAPKREIPPARRRRSPSASKSPP 422

Query: 66  CRWR----------PRRRPQPPQTATRAP 10
              R          PRRR  P Q+ + AP
Sbjct: 423 APKRAKSRSKSPPAPRRRRSPSQSKSPAP 451

 Score = 53.1 bits (126), Expect = 1e-05
 Identities = 40/126 (31%), Positives = 59/126 (46%), Gaps = 11/126 (8%)
 Frame = -1

Query: 354 PPFTRRGRGRWR--PGRRATGAAA---PPCGRRRSGPPAPCAGPPPAP----PPGRPPRT 202
           PP  +R + R +  P RR    +A   PP  RRR    +P     PAP    PP R  R+
Sbjct: 358 PPAPKRAKSRSKSPPARRRRSPSASKSPPAPRRRR---SPSKSRSPAPKREIPPARRRRS 414

Query: 201 PAVACCKTPWSPRATSWRPRRRPAPSRAAAPARRSGRCAAAGRQPCR--WRPRRRPQPPQ 28
           P+ +  K+P +P+    R +  PAP R  +P++         R P +    PRRR  P  
Sbjct: 415 PSAS--KSPPAPKRAKSRSKSPPAPRRRRSPSQSKSPAPRRRRSPSKSPQAPRRRRSPSG 472

Query: 27  TATRAP 10
           + +R+P
Sbjct: 473 SKSRSP 478

 Score = 51.6 bits (122), Expect = 3e-05
 Identities = 46/141 (32%), Positives = 63/141 (44%), Gaps = 15/141 (10%)
 Frame = -1

Query: 381 RSSR*AGLSPPFTRRGRGRWRPGRRATGAAAPPCGRRRSGPPAPCAGPPP--------AP 226
           R S  A  SPP  RR R   +    A     PP  RRR  P A  + P P        +P
Sbjct: 376 RRSPSASKSPPAPRRRRSPSKSRSPAPKREIPPA-RRRRSPSASKSPPAPKRAKSRSKSP 434

Query: 225 PPGRPPRTPAVACCKTPWSPRATSWRP-----RRRPAPSRAAAPARRSGRCAAAGRQ--P 67
           P  R  R+P+ +    P   R+ S  P     RR P+ S++ +P RR    AA  R+  P
Sbjct: 435 PAPRRRRSPSQSKSPAPRRRRSPSKSPQAPRRRRSPSGSKSRSPRRRRSPAAAPRRRQSP 494

Query: 66  CRWRPRRRPQPPQTATRAPVP 4
            R R  RR + P +++R+  P
Sbjct: 495 QRRRSPRRRRSPSSSSRSRSP 515

 Score = 48.5 bits (114), Expect = 2e-04
 Identities = 40/129 (31%), Positives = 54/129 (41%), Gaps = 7/129 (5%)
 Frame = -1

Query: 381 RSSR*AGLSPPFTRRGRGRWRPGRRATGAAAPPCGRRRSGP-----PAPCAGPPPAPPPG 217
           R S  A  SPP  +R + R         + +PP  RRR  P     PAP     P+  P 
Sbjct: 412 RRSPSASKSPPAPKRAKSR---------SKSPPAPRRRRSPSQSKSPAPRRRRSPSKSPQ 462

Query: 216 RPPR--TPAVACCKTPWSPRATSWRPRRRPAPSRAAAPARRSGRCAAAGRQPCRWRPRRR 43
            P R  +P+ +  ++P   R+ +  PRRR +P R  +P RR        R P      R 
Sbjct: 463 APRRRRSPSGSKSRSPRRRRSPAAAPRRRQSPQRRRSPRRR--------RSPSSSSRSRS 514

Query: 42  PQPPQTATR 16
           P PP    R
Sbjct: 515 PPPPPRRPR 523

 Score = 42.7 bits (99), Expect = 0.013
 Identities = 31/105 (29%), Positives = 45/105 (42%), Gaps = 6/105 (5%)
 Frame = -1

Query: 297 AAAPPCGRRRSGPPAPCAGPPPA--PPPGRPPRTPAVACCKTPWSPRATSWRP----RRR 136
           A A    R +SG P     P  +  PPP R  R+P+ +    P   ++ S  P    RRR
Sbjct: 289 AIASVAARAKSGSPRRRRSPSASKSPPPARRRRSPSQSKSPAPKRAKSRSKSPPAPARRR 348

Query: 135 PAPSRAAAPARRSGRCAAAGRQPCRWRPRRRPQPPQTATRAPVPR 1
            +PS + +P     R  +  + P    P RR + P  +   P PR
Sbjct: 349 RSPSASKSPPPAPKRAKSRSKSP----PARRRRSPSASKSPPAPR 389

 Score = 34.7 bits (78), Expect = 3.6
 Identities = 38/134 (28%), Positives = 55/134 (40%), Gaps = 12/134 (8%)
 Frame = +1

Query: 16  PCRRLRRLRPPPGPPAAWLPAGCCAPPAAARRRCCATRRRPPARAP---*CRAR*PRCFA 186
           P RR R       P      +   +PPA ARRR   +  + P  AP     R++ P    
Sbjct: 316 PARRRRSPSQSKSPAPKRAKSRSKSPPAPARRRRSPSASKSPPPAPKRAKSRSKSPPARR 375

Query: 187 TRDSWCTR---RATRWRCGWRTRTRRRRT*APPA-AWRCCSACRSPARPPPATSASR--- 345
            R    ++      R R   ++R+   +   PPA   R  SA +SP  P  A S S+   
Sbjct: 376 RRSPSASKSPPAPRRRRSPSKSRSPAPKREIPPARRRRSPSASKSPPAPKRAKSRSKSPP 435

Query: 346 --KRRREPCSTATP 381
             +RRR P  + +P
Sbjct: 436 APRRRRSPSQSKSP 449

>dbj|BAC83819.1| hypothetical protein [Oryza sativa (japonica cultivar-group)]
          Length = 630

 Score = 55.8 bits (133), Expect = 2e-06
 Identities = 45/121 (37%), Positives = 50/121 (41%), Gaps = 6/121 (4%)
 Frame = -1

Query: 357 SPPFTRRG--RGRWRPGRRATGAAAPPCGRRRSGPPAPCAGPPPAPPPGRPPRTPAVACC 184
           SPP  RR   R R  P RR    + PP   R  GPPAP    P       PP  P   CC
Sbjct: 483 SPPTCRRHGCRRRHHPRRRRRTGSEPPPDLREGGPPAPNLHRPVVARRHPPP--PLAPCC 540

Query: 183 KTPWSPRATSWRPRRRPAPSRAAAPAR----RSGRCAAAGRQPCRWRPRRRPQPPQTATR 16
             P      + +PRR P P R   P R    RS RC      P   RPRR P  P  ++ 
Sbjct: 541 PPP------AAQPRRLPPPPR-CGPRRSHLGRSARCPLPAPAP---RPRRPPPTPSASSS 590

Query: 15  A 13
           A
Sbjct: 591 A 591

 Score = 39.3 bits (90), Expect = 0.15
 Identities = 30/84 (35%), Positives = 36/84 (42%), Gaps = 2/84 (2%)
 Frame = -1

Query: 288 PPCGRRRS--GPPAPCAGPPPAPPPGRPPRTPAVACCKTPWSPRATSWRPRRRPAPSRAA 115
           P CG RRS  G  A C  P PAP P RPP TP+ +   T  +   +        AP  A 
Sbjct: 554 PRCGPRRSHLGRSARCPLPAPAPRPRRPPPTPSASSSATLHAAHCS--------APPAAR 605

Query: 114 APARRSGRCAAAGRQPCRWRPRRR 43
           +     GR     R+  R R R R
Sbjct: 606 SRRLLLGRAQIEERKRERERGRER 629

>ref|NP_862421.1| putative hydroxyproline-rich protein [Micrococcus sp. 28]
           gi|18025409|gb|AAK62517.1| putative hydroxyproline-rich
           protein [Micrococcus sp. 28]
          Length = 406

 Score = 55.8 bits (133), Expect = 2e-06
 Identities = 58/201 (28%), Positives = 76/201 (36%), Gaps = 14/201 (6%)
 Frame = -1

Query: 561 TAAYRSPTAVQSRAQRTH-TDVTVCAAKYNQGPRAPGNCKLLARRE*CRLVQAEHCTLGP 385
           TA    P A+ S  + T  T   +C +     P  PG  +                   P
Sbjct: 14  TATNHRPVAMNSTTRTTRGTMAMLCKSVKPHRPLRPGTVRFPNT---------------P 58

Query: 384 CRSSR*AGLS---PPFTRR-GRGRWRPGRRATGAAAPPCGRRRSGPPAPCAGPPPAPPPG 217
           C  SR A L+   PP +R  G  + RP        + P  ++RSGP  P A P PA P  
Sbjct: 59  CWGSRTAALTADPPPLSRSSGPDQCRP--------SSPAHQQRSGPHGPSARPWPARPDD 110

Query: 216 RPPRTPAVACCKTPWSPRATSWRPRRRPAPSRAAAPARRSGRCAAA--------GRQP-C 64
            P   PA       WS +   WRPR+RP    +   + RS R + A        G  P  
Sbjct: 111 APCAVPA-------WSSKHPWWRPRQRPEHPCSRCGSARSARTSHATPPAGPTQGHVPEL 163

Query: 63  RWRPRRRPQPPQTATRAPVPR 1
             RP  R + P    R P P+
Sbjct: 164 ALRPSPRDRHPAHRNRRPTPQ 184

 Score = 46.6 bits (109), Expect = 0.001
 Identities = 48/138 (34%), Positives = 52/138 (36%), Gaps = 12/138 (8%)
 Frame = -1

Query: 387 PCRSSR*AGLSPPFTRRGRGR---WRPGRRATGAAAPP-CGRRRSGPPAPCAGPPPAPPP 220
           PCR  R   L  P TRR R R     PG R      PP C      P      PP  PPP
Sbjct: 283 PCRRCR--QLHRPRTRRHRHRSPTHHPGLRPHPPRRPPHCWET---PRLSHRHPPADPPP 337

Query: 219 GRPPRTPAVACCKTPWSPRATSW--RPRRRPAPSRAAAPARRS--GRCAAAGRQPCRW-- 58
            RP R P+              W  RPR RP P R+    RR+      AA   P RW  
Sbjct: 338 SRPWRRPS-------------RWLHRPRHRPGPRRSGKRPRRTCPSSSEAARPGPPRWPT 384

Query: 57  --RPRRRPQPPQTATRAP 10
             +P  RP P     R P
Sbjct: 385 GRQPPGRPPPRLDPLRCP 402

 Score = 35.8 bits (81), Expect = 1.6
 Identities = 35/143 (24%), Positives = 50/143 (34%), Gaps = 27/143 (18%)
 Frame = -1

Query: 351 PFTRRGRGRWRPGRRATGAAAPPCGR----------------RRSGPPAPCAGPPPAPPP 220
           P +R G  R      AT  A P  G                  R+  P P A P P   P
Sbjct: 134 PCSRCGSARSARTSHATPPAGPTQGHVPELALRPSPRDRHPAHRNRRPTPQAEPAPHHSP 193

Query: 219 GRPPRTPAVACCKTPWS-----------PRATSWRPRRRPAPSRAAAPARRSGRCAAAGR 73
            R P +P     + P +           P+ T  +P +RP   R      +  R A+  R
Sbjct: 194 RRRPGSPRKRRERHPTARHPKPGRGPRRPQGTRHQPEQRPRTPRRRWRPNQPARPASRPR 253

Query: 72  QPCRWRPRRRPQPPQTATRAPVP 4
            P R RP +  +  + +   P+P
Sbjct: 254 PPSRQRPGQLRRTARASRHRPMP 276

>ref|XP_233556.2| similar to Ser/Arg-related nuclear matrix protein;
           plenty-of-prolines-101; serine/arginine repetitive
           matrix protein 1 [Rattus norvegicus]
          Length = 958

 Score = 55.8 bits (133), Expect = 2e-06
 Identities = 39/118 (33%), Positives = 51/118 (43%), Gaps = 1/118 (0%)
 Frame = -1

Query: 351 PFTRRGRGRWRPGRRATGAAAPPCGRRRSGPPAPCAGPPPAPPPGRPPRTPAVACCKTPW 172
           P  R+ +    P RR    + PP  RRRS  PAP   PPP P   R P  P      +P 
Sbjct: 580 PSPRKRQKETSPRRRRRSPSPPPARRRRSPSPAPPPPPPPPPRRRRSPTPPPRRRTPSP- 638

Query: 171 SPRATSWRPRRRPAP-SRAAAPARRSGRCAAAGRQPCRWRPRRRPQPPQTATRAPVPR 1
            PR  S  PRR   P  R  +P+    R  A+   P + R    P P +  + +P P+
Sbjct: 639 PPRRRSPSPRRYSPPIQRRYSPSPPPKRRTASPPPPPKRRASPSPPPKRRVSHSPPPK 696

 Score = 42.7 bits (99), Expect = 0.013
 Identities = 39/125 (31%), Positives = 51/125 (40%), Gaps = 6/125 (4%)
 Frame = -1

Query: 357 SPPFTRRGRGRWRPGRRATGAAAPPCGRRRSGPPAPCAGPPPAPPPGR--PP----RTPA 196
           SPP  RR      P RR T +  PP  RR S  P P      +PPP +  PP    R+P+
Sbjct: 651 SPPIQRRYSPSPPPKRR-TASPPPPPKRRASPSPPPKRRVSHSPPPKQRSPPVTKRRSPS 709

Query: 195 VACCKTPWSPRATSWRPRRRPAPSRAAAPARRSGRCAAAGRQPCRWRPRRRPQPPQTATR 16
           ++      S    S R  R P P++                   R  P  RP+ PQT++ 
Sbjct: 710 LSSKHRKGSSPGRSTREARSPQPNK-------------------RHSPSPRPRAPQTSSP 750

Query: 15  APVPR 1
            PV R
Sbjct: 751 PPVRR 755

 Score = 41.2 bits (95), Expect = 0.039
 Identities = 38/134 (28%), Positives = 54/134 (39%), Gaps = 9/134 (6%)
 Frame = -1

Query: 375 SR*AGLSPPFTR-----RGRGRWRPGRRATGAAAPPCGRRRSGPPAPCAGPPP---APPP 220
           SR    SP  TR     R R R    RR       P  RRR+ PP     PP    +  P
Sbjct: 343 SRTRSRSPSHTRPRRRHRSRSRSYSPRRRPSPRRRPSPRRRT-PPRRMPPPPRHRRSRSP 401

Query: 219 GRPPRTPAVACCKTPWSPRATSWRPRRRPAPSRAAAPARRSGRCAAAGRQPCR-WRPRRR 43
           GR  R  + +   +  S  ++  R   +  P R ++P R++ R + +   P R  RP   
Sbjct: 402 GRRRRRSSASLSGSSSSSSSSRSRSPPKKPPKRTSSPPRKTRRLSPSASPPRRRHRPSSP 461

Query: 42  PQPPQTATRAPVPR 1
             PP     +P P+
Sbjct: 462 ATPPPKTRHSPTPQ 475

 Score = 40.8 bits (94), Expect = 0.051
 Identities = 33/120 (27%), Positives = 51/120 (42%), Gaps = 9/120 (7%)
 Frame = -1

Query: 357  SPPFTRRGRGRWRPGRRATGAAAPPCGRRRSGPPAPCAGPPPAPPPGRPPRTPAVACCKT 178
            SP  + + R    PGR    A +P   +R S  P P A    +PPP R   + +    ++
Sbjct: 707  SPSLSSKHRKGSSPGRSTREARSPQPNKRHSPSPRPRAPQTSSPPPVRRGASASPQGRQS 766

Query: 177  PWSPRATSWRPRRRPAP---SRAAAPARRSGRCAAAGR------QPCRWRPRRRPQPPQT 25
            P        R  R P P    +AA+P+ +S R  ++ R      +P   +P   P P Q+
Sbjct: 767  PSPSTRPIRRVSRTPEPKKIKKAASPSPQSVRRVSSSRSVSGSPEPTAKKPPAPPSPVQS 826

 Score = 37.4 bits (85), Expect = 0.56
 Identities = 22/60 (36%), Positives = 32/60 (52%)
 Frame = -1

Query: 276 RRRSGPPAPCAGPPPAPPPGRPPRTPAVACCKTPWSPRATSWRPRRRPAPSRAAAPARRS 97
           R  SG P P A  PPAPP     ++P+     T WSP A +   ++  +P+ + +PAR S
Sbjct: 804 RSVSGSPEPTAKKPPAPPSPVQSQSPS-----TNWSPAAPA---KKAKSPTPSPSPARNS 855

 Score = 36.2 bits (82), Expect = 1.3
 Identities = 32/116 (27%), Positives = 44/116 (37%)
 Frame = -1

Query: 354 PPFTRRGRGRWRPGRRATGAAAPPCGRRRSGPPAPCAGPPPAPPPGRPPRTPAVACCKTP 175
           PP  RR R    PGRR   ++A   G   S   +    PP  PP                
Sbjct: 392 PPRHRRSRS---PGRRRRRSSASLSGSSSSSSSSRSRSPPKKPP---------------- 432

Query: 174 WSPRATSWRPRRRPAPSRAAAPARRSGRCAAAGRQPCRWRPRRRPQPPQTATRAPV 7
              + TS  PR+    S +A+P RR  R ++    P + R    PQ    A ++ V
Sbjct: 433 ---KRTSSPPRKTRRLSPSASPPRRRHRPSSPATPPPKTRHSPTPQQSNRARKSRV 485

>gb|AAK61383.1| basic proline-rich protein [Sus scrofa]
          Length = 676

 Score = 55.5 bits (132), Expect = 2e-06
 Identities = 40/121 (33%), Positives = 48/121 (39%), Gaps = 1/121 (0%)
 Frame = -1

Query: 363 GLSPPFTRRGRGRWRPGRRATGAAAPPCGRRRSGPPAPCAGPP-PAPPPGRPPRTPAVAC 187
           G +PP  R   G   PG    G A PP  R   GPP P   PP PAPP  RPP  P    
Sbjct: 365 GPAPPGARPPPGPPPPGPPPPGPA-PPGARPPPGPPPPGPPPPGPAPPGARPPPPPPPPA 423

Query: 186 CKTPWSPRATSWRPRRRPAPSRAAAPARRSGRCAAAGRQPCRWRPRRRPQPPQTATRAPV 7
            +    P  +  +P+++P P     P        + G  P   RP   P PP      P 
Sbjct: 424 DEPQQGPAPSGDKPKKKPPPPAGPPPPGP----PSPGPAPPGARPPPGPPPPGPPPPGPA 479

Query: 6   P 4
           P
Sbjct: 480 P 480

 Score = 48.9 bits (115), Expect = 2e-04
 Identities = 41/130 (31%), Positives = 43/130 (32%), Gaps = 10/130 (7%)
 Frame = -1

Query: 363 GLSPPFTRRGRGRWRPGRRATGAAAP---------PCGRRRSGPPAPCAGPPPAPP-PGR 214
           G +PP  R   G   PG    G A P         P G    GP  P A PPP PP PG 
Sbjct: 218 GPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPLGPPPPGPAPPGARPPPGPPPPGP 277

Query: 213 PPRTPAVACCKTPWSPRATSWRPRRRPAPSRAAAPARRSGRCAAAGRQPCRWRPRRRPQP 34
           PP  PA    + P  P      P     P     P          G  P   RP   P P
Sbjct: 278 PPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPP 337

Query: 33  PQTATRAPVP 4
           P      P P
Sbjct: 338 PGPPPPGPAP 347

 Score = 48.1 bits (113), Expect = 3e-04
 Identities = 41/130 (31%), Positives = 43/130 (32%), Gaps = 10/130 (7%)
 Frame = -1

Query: 363 GLSPPFTRRGRGRWRPGRRATGAAAP---------PCGRRRSGPPAPCAGPPPAPP-PGR 214
           G +PP  R   G   PG    G A P         P G    GP  P A PPP PP PG 
Sbjct: 477 GPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGP 536

Query: 213 PPRTPAVACCKTPWSPRATSWRPRRRPAPSRAAAPARRSGRCAAAGRQPCRWRPRRRPQP 34
           PP  PA    + P  P      P     P     P          G  P   RP   P P
Sbjct: 537 PPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPP 596

Query: 33  PQTATRAPVP 4
           P      P P
Sbjct: 597 PGPPPPGPAP 606

 Score = 48.1 bits (113), Expect = 3e-04
 Identities = 41/130 (31%), Positives = 43/130 (32%), Gaps = 10/130 (7%)
 Frame = -1

Query: 363 GLSPPFTRRGRGRWRPGRRATGAAAP---------PCGRRRSGPPAPCAGPPPAPP-PGR 214
           G +PP  R   G   PG    G A P         P G    GP  P A PPP PP PG 
Sbjct: 92  GPAPPGARPPPGPPPPGPPPPGPAPPDARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGP 151

Query: 213 PPRTPAVACCKTPWSPRATSWRPRRRPAPSRAAAPARRSGRCAAAGRQPCRWRPRRRPQP 34
           PP  PA    + P  P      P     P     P          G  P   RP   P P
Sbjct: 152 PPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPP 211

Query: 33  PQTATRAPVP 4
           P      P P
Sbjct: 212 PGPPPPGPAP 221

 Score = 47.8 bits (112), Expect = 4e-04
 Identities = 42/121 (34%), Positives = 43/121 (34%), Gaps = 1/121 (0%)
 Frame = -1

Query: 363 GLSPPFTRRGRGRWRPGRRATGAAAPPCGRRRSGPPAPCAGPP-PAPPPGRPPRTPAVAC 187
           G +PP  R   G   PG    G A PP  R   GPP P   PP PAPP  RPP  P    
Sbjct: 197 GPAPPGARPPPGPPPPGPPPPGPA-PPGARPPPGPPPPGPPPPGPAPPGARPPPGPP-PL 254

Query: 186 CKTPWSPRATSWRPRRRPAPSRAAAPARRSGRCAAAGRQPCRWRPRRRPQPPQTATRAPV 7
              P  P     RP   P P     P          G  P   RP   P PP      P 
Sbjct: 255 GPPPPGPAPPGARPPPGPPPPGPPPP----------GPAPPGARPPPGPPPPGPPPPGPA 304

Query: 6   P 4
           P
Sbjct: 305 P 305

 Score = 47.0 bits (110), Expect = 7e-04
 Identities = 41/126 (32%), Positives = 42/126 (32%), Gaps = 5/126 (3%)
 Frame = -1

Query: 366 AGLSPPFTRRGRGRWRPGRRATGA----AAPPCGRRRSGPPAPCAGPPPAPP-PGRPPRT 202
           AG  PP      G   PG    GA      PP G    GP  P A PPP PP PG PP  
Sbjct: 445 AGPPPP------GPPSPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPG 498

Query: 201 PAVACCKTPWSPRATSWRPRRRPAPSRAAAPARRSGRCAAAGRQPCRWRPRRRPQPPQTA 22
           PA    + P  P      P     P     P          G  P   RP   P PP   
Sbjct: 499 PAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPP 558

Query: 21  TRAPVP 4
              P P
Sbjct: 559 PPGPAP 564

 Score = 46.2 bits (108), Expect = 0.001
 Identities = 41/121 (33%), Positives = 42/121 (33%), Gaps = 1/121 (0%)
 Frame = -1

Query: 363 GLSPPFTRRGRGRWRPGRRATGAAAPPCGRRRSGPPAPCAGPP-PAPPPGRPPRTPAVAC 187
           G +PP      G   PG    G A PP  R   GPP P   PP PAPP  RPP  P    
Sbjct: 71  GPAPPGAEPPPGPPPPGPPPPGPA-PPGARPPPGPPPPGPPPPGPAPPDARPPPGPPPPG 129

Query: 186 CKTPWSPRATSWRPRRRPAPSRAAAPARRSGRCAAAGRQPCRWRPRRRPQPPQTATRAPV 7
              P  P     RP   P P     P          G  P   RP   P PP      P 
Sbjct: 130 PPPP-GPAPPGARPPPGPPPPGPPPP----------GPAPPGARPPPGPPPPGPPPPGPA 178

Query: 6   P 4
           P
Sbjct: 179 P 179

 Score = 45.8 bits (107), Expect = 0.002
 Identities = 42/123 (34%), Positives = 44/123 (35%), Gaps = 12/123 (9%)
 Frame = -1

Query: 363 GLSPPFTRRGRGRWRPGRRATGAAAP---------PCGRRRSGPPAPCAGPPPAPP-PGR 214
           G +PP  R   G   PG    G A P         P G    GP  P A PPP PP PG 
Sbjct: 302 GPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGP 361

Query: 213 PPRTPAVACCKTPWSPRATSWRPRRRPAPSRAAAPARR--SGRCAAAGRQPCRWRPRRRP 40
           PP  PA    + P  P      P   P P   A P  R   G        P    P  RP
Sbjct: 362 PPPGPAPPGARPPPGP------PPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARP 415

Query: 39  QPP 31
            PP
Sbjct: 416 PPP 418

 Score = 44.3 bits (103), Expect = 0.005
 Identities = 26/54 (48%), Positives = 28/54 (51%), Gaps = 1/54 (1%)
 Frame = -1

Query: 363 GLSPPFTRRGRGRWRPGRRATGAAAPPCGRRRSGPPAPCAGP-PPAPPPGRPPR 205
           G +PP  R   G   PG    G A PP  R   GPP P  GP PP PPPG PP+
Sbjct: 624 GPAPPGARPPPGPPPPGPPPPGPA-PPGARPPPGPPPPPPGPSPPRPPPGPPPQ 676

 Score = 44.3 bits (103), Expect = 0.005
 Identities = 40/129 (31%), Positives = 41/129 (31%), Gaps = 9/129 (6%)
 Frame = -1

Query: 363 GLSPPFTRRGRGRWRPGRRATGAAAP---------PCGRRRSGPPAPCAGPPPAPPPGRP 211
           G +PP  R   G   PG    G A P         P G    GP  P A PPP PPP  P
Sbjct: 134 GPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGP 193

Query: 210 PRTPAVACCKTPWSPRATSWRPRRRPAPSRAAAPARRSGRCAAAGRQPCRWRPRRRPQPP 31
           P          P  P     RP   P P     P          G  P   RP   P PP
Sbjct: 194 P----------PPGPAPPGARPPPGPPPPGPPPP----------GPAPPGARPPPGPPPP 233

Query: 30  QTATRAPVP 4
                 P P
Sbjct: 234 GPPPPGPAP 242

 Score = 43.9 bits (102), Expect = 0.006
 Identities = 42/128 (32%), Positives = 45/128 (34%), Gaps = 10/128 (7%)
 Frame = -1

Query: 363 GLSPPFTRRGRGRWRPGRRATGAAAP---------PCGRRRSGPPAPCAGPPPAPP-PGR 214
           G +PP  R   G   PG    G A P         P G    GP  P A PPP PP PG 
Sbjct: 561 GPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGP 620

Query: 213 PPRTPAVACCKTPWSPRATSWRPRRRPAPSRAAAPARRSGRCAAAGRQPCRWRPRRRPQP 34
           PP  PA    + P  P      P   P P   A P  R       G  P    P   P P
Sbjct: 621 PPPGPAPPGARPPPGP------PPPGPPPPGPAPPGAR----PPPGPPP----PPPGPSP 666

Query: 33  PQTATRAP 10
           P+     P
Sbjct: 667 PRPPPGPP 674

 Score = 37.7 bits (86), Expect = 0.43
 Identities = 39/124 (31%), Positives = 42/124 (33%), Gaps = 4/124 (3%)
 Frame = -1

Query: 363 GLSPPFTRRGRGRWRPGRRATGAAAPPCGRRRSGPPAPCAGPP---PAPPPGRPPRTPAV 193
           G +PP  R   G   PG    G A P  G R   PP P A  P   PAP   +P + P  
Sbjct: 386 GPAPPGARPPPGPPPPGPPPPGPAPP--GARPPPPPPPPADEPQQGPAPSGDKPKKKPPP 443

Query: 192 ACCKTPWSPRATSWRPRRRPAPSRA-AAPARRSGRCAAAGRQPCRWRPRRRPQPPQTATR 16
                P  P      P   PAP  A   P          G  P   RP   P PP     
Sbjct: 444 PAGPPPPGP------PSPGPAPPGARPPPGPPPPGPPPPGPAPPGARPPPGPPPPGPPPP 497

Query: 15  APVP 4
            P P
Sbjct: 498 GPAP 501

 Score = 36.6 bits (83), Expect = 0.96
 Identities = 37/125 (29%), Positives = 38/125 (29%), Gaps = 8/125 (6%)
 Frame = -1

Query: 354 PPFTRRGRGRW-RPGRRATGAAAPPCGRRRSGPPAPCAGPPPAPPP-------GRPPRTP 199
           PP   +G G   RP     G    P       PP P   PPP PPP        RPP  P
Sbjct: 48  PPEESQGEGHQKRPRPPGDGPEQGPAPPGAEPPPGP---PPPGPPPPGPAPPGARPPPGP 104

Query: 198 AVACCKTPWSPRATSWRPRRRPAPSRAAAPARRSGRCAAAGRQPCRWRPRRRPQPPQTAT 19
                  P  P     RP   P P     P          G  P   RP   P PP    
Sbjct: 105 PPPGPPPP-GPAPPDARPPPGPPPPGPPPP----------GPAPPGARPPPGPPPPGPPP 153

Query: 18  RAPVP 4
             P P
Sbjct: 154 PGPAP 158



EST assemble image


clone accession position
1 HCL095d10_r AV644912 1 326
2 HCL094b06_r AV644812 56 459
3 HCL080h01_r AV644048 84 483
4 LCL021b03_r AV627100 141 316
5 HCL093c04_r AV644748 162 590
6 HCL070h12_r AV643515 171 523
7 HCL033e08_r AV641434 327 703
8 HCL028d02_r AV641136 478 923
9 CL38c02_r AV395287 485 969
10 HCL043a11_r AV641958 511 929
11 HCL055c12_r AV642648 586 1086
12 CL71d09_r AV396908 641 1266
13 CL28d05_r AV394804 741 1211




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research