KCC000427A_c02
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000427A_C02 KCC000427A_c02
cgaaccaacatttcatgaataaagagtCAGACGCGGTGTCTTCGCAACAGGACCCCAGGC
CTTCCTTTTTGCTGAGTACATGTTTTCACTCCAAGAAAATTTGAATTATACACCTACCAA
AGCGCTTACATATTGGACTTGAATAACTCGTGATAGCCTGCTGAATCGGGAGGCCGACAG
CCAGCCGTCTGCGACCCGCGACAGCTTGGCCCTTTCGAAAGCTGTTCAGTATAACACGAA
TAAGAGCTACGTTTTAAATGCGTGCCTTAGACAGAAGCAGCGGGAGAACGGGTCGGCTGG
GGCAGCGATGCACTGCCTCACTGCTGCTGACTCCCGGGCACCTGCTGCTTTCCGGGGAGC
CGCGGCAACACCATGGGAAACTTGGGAGAGCGCGAGGCTCGATGGCATGCCGCGCCACGG
CTGCGGCGCCAGCGCGGAAAGAGGCGGGAACCAC


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000427A_C02 KCC000427A_c02
         (454 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|NP_300030.1| hypothetical protein [Xylella fastidiosa 9a5c] ...    34  0.87
ref|NP_628228.1| hypothetical protein 2SCD60.12c [Streptomyces c...    33  1.9
ref|NP_422512.1| TPR domain protein [Caulobacter crescentus CB15...    32  2.5
ref|ZP_00081885.1| COG0475: Kef-type K+ transport systems, membr...    32  3.3
ref|XP_195125.1| similar to mitogen-activated protein kinase ass...    32  3.3

>ref|NP_300030.1| hypothetical protein [Xylella fastidiosa 9a5c]
           gi|11292931|pir||E82520 hypothetical protein XF2753
           [imported] - Xylella fastidiosa  (strain 9a5c)
           gi|9107995|gb|AAF85538.1|AE004081_10 hypothetical
           protein [Xylella fastidiosa 9a5c]
          Length = 320

 Score = 33.9 bits (76), Expect = 0.87
 Identities = 16/49 (32%), Positives = 27/49 (54%)
 Frame = -2

Query: 420 PWRGMPSSLALSQVSHGVAAAPRKAAGARESAAVRQCIAAPADPFSRCF 274
           PWR + +++AL  V+H VAA    +A     AA +  ++ P + F+  F
Sbjct: 27  PWRFIITAIALLCVAHTVAAVAPASAAEHVQAAAKPTVSCPGEDFTTFF 75

>ref|NP_628228.1| hypothetical protein 2SCD60.12c [Streptomyces coelicolor A3(2)]
           gi|13122139|emb|CAC32317.1| hypothetical protein
           2SCD60.12c [Streptomyces coelicolor A3(2)]
          Length = 152

 Score = 32.7 bits (73), Expect = 1.9
 Identities = 25/66 (37%), Positives = 32/66 (47%), Gaps = 3/66 (4%)
 Frame = -2

Query: 447 PPLSALAPQPW-RGMPSSLALSQVSHGVAAAPRKAAGARESAAVRQCIAAPADPFSRCF- 274
           PP +   P+P  RG P++ A S+  H  AAA  +AAGA    A     A P  P +R   
Sbjct: 86  PPPTPRVPRPAVRGSPAAAASSR--HSAAAAGSRAAGAARVGAAAPRNAGPRSPRARTHP 143

Query: 273 -CLRHA 259
            C  HA
Sbjct: 144 GCQDHA 149

>ref|NP_422512.1| TPR domain protein [Caulobacter crescentus CB15]
           gi|25398964|pir||D87710 TPR domain protein [imported] -
           Caulobacter crescentus gi|13425486|gb|AAK25680.1| TPR
           domain protein [Caulobacter crescentus CB15]
          Length = 596

 Score = 32.3 bits (72), Expect = 2.5
 Identities = 21/52 (40%), Positives = 28/52 (53%)
 Frame = -2

Query: 447 PPLSALAPQPWRGMPSSLALSQVSHGVAAAPRKAAGARESAAVRQCIAAPAD 292
           P  +ALA    R    S AL+ + H VAAAPR+AA     AA+   +  PA+
Sbjct: 102 PVFNALAVSLQRLGGFSEALAAIDHAVAAAPREAAYRAHRAALLVLLNRPAE 153

>ref|ZP_00081885.1| COG0475: Kef-type K+ transport systems, membrane components
           [Geobacter metallireducens]
          Length = 762

 Score = 32.0 bits (71), Expect = 3.3
 Identities = 19/58 (32%), Positives = 26/58 (44%)
 Frame = -3

Query: 446 RLFPRWRRSRGAACHRASRSPKFPMVLPRLPGKQQVPGSQQQ*GSASLPQPTRSPAAS 273
           RL P WR + G      SR  ++P   P L  + Q PG ++  G A   +P   P  S
Sbjct: 36  RLHPPWREAHGTGRGSGSRGGRYPRRPPGL-RQGQGPGREESGGGAGAARPEALPLMS 92

>ref|XP_195125.1| similar to mitogen-activated protein kinase associated protein 1;
           ras inhibitor MGC2745; hypothetical protein MGC2745
           [Homo sapiens] [Mus musculus]
          Length = 693

 Score = 32.0 bits (71), Expect = 3.3
 Identities = 26/71 (36%), Positives = 32/71 (44%), Gaps = 3/71 (4%)
 Frame = -2

Query: 453 WFPPL--SALAPQPWRGMPSSLALSQVSHGVAAAPRKAA-GARESAAVRQCIAAPADPFS 283
           WFP L  SAL+  PW    SS +   V    ++ P K A G R+ A V Q   +P D   
Sbjct: 125 WFPRLEMSALSVTPWLSFCSSNSRDTVGWRDSSNPHKVAKGKRQKATVAQ---SPIDQSK 181

Query: 282 RCFCLRHAFKT 250
           R  C    F T
Sbjct: 182 RGQCCYRWFGT 192



EST assemble image


clone accession position
1 HCL059g02_r AV642877 1 454
2 LCL069e12_r AV629945 28 439




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research