KCC000426A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000426A_C01 KCC000426A_c01
gagaacctccgtcaatgcgtgatgataaagtctgtattctgaaAGAGACCGCAATAAGGT
ATGCCCGCCGGGAGGAATTCTTCCAATGGGTAAGGTCTAGACCATTCTTGGTTTGTTCCT
CTGTTTAGTCCGACGACGAGGATGGGGACAGGCGACAACTAGAGCAGGCATGGGTTGCAA
ATTACGTGCAGATAGCTGCGCGCTTGGGCAGTAGGTGCATGATTGACAGGTGGGCGACAT
GCGGTGCGGGCAAGTGAGGAGTGCGACTGGGAGAAGCCTACTTGATTTCAACGTTGACTT
CATCCGCGGGATGGCACAGTGTTTGATTTGCGCTGAGTTAGTGTTGGTTGGGCCTAAAAG
TATTTGCACACACGTTGCGGAGGTAAGGGTTGCAAGGACTGCTCCACCAAGGGAAAGGAT
GAGGTGCCTGCCTACGCGGGTGGCCGGTCGCTGCCAGTTGTAGGGGAGGGCAGCGTGGGC
AGAGGCAGGGAAGGCGGGATGCGGGCTGGACAGGCGAGCAACAGAATGCTTGAAACTTGA
AAGCGGTATCTGGTGACATGATGAG


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000426A_C01 KCC000426A_c01
         (565 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|NP_006268.1| intersectin 2 isoform 1; SH3 domain protein 1B;...    37  0.18
gb|AAF59903.1|AF182198_1 intersectin 2 long isoform [Homo sapiens]     37  0.18
dbj|BAA86570.1| KIAA1256 protein [Homo sapiens]                        37  0.18
gb|AAH20921.1| ITSN2 protein [Homo sapiens]                            37  0.18
ref|NP_062541.2| intersectin 2 isoform 3; SH3 domain protein 1B;...    37  0.18

>ref|NP_006268.1| intersectin 2 isoform 1; SH3 domain protein 1B; SH3P18-like WASP
           associated protein [Homo sapiens]
           gi|20138768|sp|Q9NZM3|ITN2_HUMAN Intersectin 2 (SH3
           domain-containing protein 1B) (SH3P18) (SH3P18-like WASP
           associated protein)
          Length = 1696

 Score = 37.0 bits (84), Expect = 0.18
 Identities = 22/64 (34%), Positives = 33/64 (51%), Gaps = 9/64 (14%)
 Frame = -3

Query: 545 RFQVSSILLLACPARIPPSLPLPTLPSPTTGSDRPPA*AGTSSFPLVEQS---------L 393
           RF + S+  L+ P  +PP+ P+ +L S T+G++ PP    T   P V  S         +
Sbjct: 115 RFGMGSMPNLSIPQPLPPAAPITSLSSATSGTNLPPLMMPTPLVPSVSTSSLPNGTASLI 174

Query: 392 QPLP 381
           QPLP
Sbjct: 175 QPLP 178

>gb|AAF59903.1|AF182198_1 intersectin 2 long isoform [Homo sapiens]
          Length = 1696

 Score = 37.0 bits (84), Expect = 0.18
 Identities = 22/64 (34%), Positives = 33/64 (51%), Gaps = 9/64 (14%)
 Frame = -3

Query: 545 RFQVSSILLLACPARIPPSLPLPTLPSPTTGSDRPPA*AGTSSFPLVEQS---------L 393
           RF + S+  L+ P  +PP+ P+ +L S T+G++ PP    T   P V  S         +
Sbjct: 115 RFGMGSMPNLSIPQPLPPAAPITSLSSATSGTNLPPLMMPTPLVPSVSTSSLPNGTASLI 174

Query: 392 QPLP 381
           QPLP
Sbjct: 175 QPLP 178

>dbj|BAA86570.1| KIAA1256 protein [Homo sapiens]
          Length = 1676

 Score = 37.0 bits (84), Expect = 0.18
 Identities = 22/64 (34%), Positives = 33/64 (51%), Gaps = 9/64 (14%)
 Frame = -3

Query: 545 RFQVSSILLLACPARIPPSLPLPTLPSPTTGSDRPPA*AGTSSFPLVEQS---------L 393
           RF + S+  L+ P  +PP+ P+ +L S T+G++ PP    T   P V  S         +
Sbjct: 122 RFGMGSMPNLSIPQPLPPAAPITSLSSATSGTNLPPLMMPTPLVPSVSTSSLPNGTASLI 181

Query: 392 QPLP 381
           QPLP
Sbjct: 182 QPLP 185

>gb|AAH20921.1| ITSN2 protein [Homo sapiens]
          Length = 560

 Score = 37.0 bits (84), Expect = 0.18
 Identities = 22/64 (34%), Positives = 33/64 (51%), Gaps = 9/64 (14%)
 Frame = -3

Query: 545 RFQVSSILLLACPARIPPSLPLPTLPSPTTGSDRPPA*AGTSSFPLVEQS---------L 393
           RF + S+  L+ P  +PP+ P+ +L S T+G++ PP    T   P V  S         +
Sbjct: 115 RFGMGSMPNLSIPQPLPPAAPITSLSSATSGTNLPPLMMPTPLVPSVSTSSLPNGTASLI 174

Query: 392 QPLP 381
           QPLP
Sbjct: 175 QPLP 178

>ref|NP_062541.2| intersectin 2 isoform 3; SH3 domain protein 1B; SH3P18-like WASP
           associated protein [Homo sapiens]
          Length = 1669

 Score = 37.0 bits (84), Expect = 0.18
 Identities = 22/64 (34%), Positives = 33/64 (51%), Gaps = 9/64 (14%)
 Frame = -3

Query: 545 RFQVSSILLLACPARIPPSLPLPTLPSPTTGSDRPPA*AGTSSFPLVEQS---------L 393
           RF + S+  L+ P  +PP+ P+ +L S T+G++ PP    T   P V  S         +
Sbjct: 115 RFGMGSMPNLSIPQPLPPAAPITSLSSATSGTNLPPLMMPTPLVPSVSTSSLPNGTASLI 174

Query: 392 QPLP 381
           QPLP
Sbjct: 175 QPLP 178



EST assemble image


clone accession position
1 LC033h10_r AV621290 1 528
2 CL28c09_r AV394808 44 565




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research