KCC000425A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000425A_C01 KCC000425A_c01
cgctgctGCAGCACTTGTCAACGTGCGCAAGTGAACAATACTCCTCAACAATTAGTGCTG
CATTTTAGCAATAAACGAGCGCGGCTAGCACACGACCCAACAATGCCGGTTCAGCAGATG
ACTTCTATGCGCAGCCAGTCCCTGGCTGGCTGCTCCAGTGGCACCCGTCAAGGCGGGCCG
CGCTGGCGTTTCGCGCCGTGCCCTGGCCGTCAGCGTCCGTGCTGAGAAGGTCGTGGGTAT
CGATCTGGGCACGACCAACTCGGCTGTGGCTGCCATGGAGGTGTGGCAAGCCGACCATCA
TCACCAACGCTGAGGGCGGCCGCACCACCCCCTCGGTGGTGGCGTTCACCAAGACCGGCG
ACCGTCTGGTTGGCCAGATTGCCAAGCGCCAGGCTGTGGTCAACCCCGAGAACACTTTCT
TCTCCGTAAAGCGCTTCATCGGCCGCCGCATGTCGGAGGTCGGCTCGGAGTCCACCCAAG
TGCCTTACCGGGTGATTGAGGACGGCGGCAACGTGAAGATCAAGTGCCCCAACGCCGGTA
AGGACTTCGCTCCCGAGGAGATCAGCGCGCAGGTGCTGCGCAAGCTGACGGAGGACGCCG
CCAAGTTCCTGAACGACAAGGTGGAGAAGGCGGTCATCACCGTGCCCGCCTACTTCAATG
ACTCCCAGCGCCAGGCCACCAAGGACGCGGGCAAGATTGCCGGTCTGGAGGTGCTGCGCA
TCATCAACGAGCCCACCGCCGCCTCGCTGGCGTACGGCTTTGACAAGAAGGCCAACGAGA
CCATCCTGGTGTTCGACCTTGGCGGCGGCACCTTCGATGTGTCAGTGCTGGAGGTGGGCG
ACGGCGTGTTCGAGGTGCTGTCCACCAGCGGCGACACCCACCTGGGCGGTGACGACTTCG
ACAAGCGCATCGTGGACTTCCTGGCTGATGACTTCAAGAAGAGCGAGGGCATTGACCTGC
GCAAGGACCGCCAGGCGCTACAGCGCCTGACCGAGGCGGCCGAGAAGGCCAAGATTGAGC
TGTCGGGAATGGCCCAGACCTCCATCAACCTGCCCTTCATTACTGCCACCGCCGATGGTC
CCAAGCACATCGACACCCAGCTGACCCGCGCCAAGTTCGAGGAGATGTGCAACGACCTGC
TGGAGCGCTGCAAGGTGCCGGTGCAGCAGGCCCTGCGCGATGCCAAGCTGT


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000425A_C01 KCC000425A_c01
         (1191 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

pir||T08151 dnaK-type molecular chaperone hsp70b precursor, chlo...   591  0.0
emb|CAB71138.2| heat shock protein [Dunaliella salina]                510  e-151
gb|AAL66864.1| heat shock protein 70B [Dunaliella salina]             508  e-151
sp|Q02028|HS7S_PEA Stromal 70 kDa heat shock-related protein, ch...   496  e-145
ref|NP_194159.1| heat shock protein cpHsc70-1 [Arabidopsis thali...   493  e-144

>pir||T08151 dnaK-type molecular chaperone hsp70b precursor, chloroplast -
            Chlamydomonas reinhardtii gi|1225970|emb|CAA65356.1| heat
            shock protein 70B [Chlamydomonas reinhardtii]
          Length = 679

 Score =  591 bits (1523), Expect(3) = 0.0
 Identities = 302/302 (100%), Positives = 302/302 (100%)
 Frame = +3

Query: 285  GKPTIITNAEGGRTTPSVVAFTKTGDRLVGQIAKRQAVVNPENTFFSVKRFIGRRMSEVG 464
            GKPTIITNAEGGRTTPSVVAFTKTGDRLVGQIAKRQAVVNPENTFFSVKRFIGRRMSEVG
Sbjct: 61   GKPTIITNAEGGRTTPSVVAFTKTGDRLVGQIAKRQAVVNPENTFFSVKRFIGRRMSEVG 120

Query: 465  SESTQVPYRVIEDGGNVKIKCPNAGKDFAPEEISAQVLRKLTEDAAKFLNDKVEKAVITV 644
            SESTQVPYRVIEDGGNVKIKCPNAGKDFAPEEISAQVLRKLTEDAAKFLNDKVEKAVITV
Sbjct: 121  SESTQVPYRVIEDGGNVKIKCPNAGKDFAPEEISAQVLRKLTEDAAKFLNDKVEKAVITV 180

Query: 645  PAYFNDSQRQATKDAGKIAGLEVLRIINEPTAASLAYGFDKKANETILVFDLGGGTFDVS 824
            PAYFNDSQRQATKDAGKIAGLEVLRIINEPTAASLAYGFDKKANETILVFDLGGGTFDVS
Sbjct: 181  PAYFNDSQRQATKDAGKIAGLEVLRIINEPTAASLAYGFDKKANETILVFDLGGGTFDVS 240

Query: 825  VLEVGDGVFEVLSTSGDTHLGGDDFDKRIVDFLADDFKKSEGIDLRKDRQALQRLTEAAE 1004
            VLEVGDGVFEVLSTSGDTHLGGDDFDKRIVDFLADDFKKSEGIDLRKDRQALQRLTEAAE
Sbjct: 241  VLEVGDGVFEVLSTSGDTHLGGDDFDKRIVDFLADDFKKSEGIDLRKDRQALQRLTEAAE 300

Query: 1005 KAKIELSGMAQTSINLPFITATADGPKHIDTQLTRAKFEEMCNDLLERCKVPVQQALRDA 1184
            KAKIELSGMAQTSINLPFITATADGPKHIDTQLTRAKFEEMCNDLLERCKVPVQQALRDA
Sbjct: 301  KAKIELSGMAQTSINLPFITATADGPKHIDTQLTRAKFEEMCNDLLERCKVPVQQALRDA 360

Query: 1185 KL 1190
            KL
Sbjct: 361  KL 362

 Score = 82.0 bits (201), Expect(3) = 0.0
 Identities = 43/43 (100%), Positives = 43/43 (100%)
 Frame = +2

Query: 152 APVAPVKAGRAGVSRRALAVSVRAEKVVGIDLGTTNSAVAAME 280
           APVAPVKAGRAGVSRRALAVSVRAEKVVGIDLGTTNSAVAAME
Sbjct: 17  APVAPVKAGRAGVSRRALAVSVRAEKVVGIDLGTTNSAVAAME 59

 Score = 34.3 bits (77), Expect(3) = 0.0
 Identities = 16/16 (100%), Positives = 16/16 (100%)
 Frame = +1

Query: 103 MPVQQMTSMRSQSLAG 150
           MPVQQMTSMRSQSLAG
Sbjct: 1   MPVQQMTSMRSQSLAG 16

>emb|CAB71138.2| heat shock protein [Dunaliella salina]
          Length = 670

 Score =  510 bits (1314), Expect(2) = e-151
 Identities = 260/303 (85%), Positives = 280/303 (91%), Gaps = 1/303 (0%)
 Frame = +3

Query: 285  GKPTIITNAEGGRTTPSVVAFTKTGDRLVGQIAKRQAVVNPENTFFSVKRFIGRRMSEVG 464
            GKPTIITNAEG RTTPSVVAFTK GDRLVGQIAKRQAVVNPENTFFSVKRFIGR+  EVG
Sbjct: 58   GKPTIITNAEGSRTTPSVVAFTKGGDRLVGQIAKRQAVVNPENTFFSVKRFIGRKAGEVG 117

Query: 465  SESTQVPYRVIEDGG-NVKIKCPNAGKDFAPEEISAQVLRKLTEDAAKFLNDKVEKAVIT 641
             E+ QVPYRV+E    NVKI   +AGK+FAPEEIS+QVLRKLT DA+KFLNDKVEKAVIT
Sbjct: 118  EETKQVPYRVVEGSDRNVKIFSSHAGKEFAPEEISSQVLRKLTADASKFLNDKVEKAVIT 177

Query: 642  VPAYFNDSQRQATKDAGKIAGLEVLRIINEPTAASLAYGFDKKANETILVFDLGGGTFDV 821
            VPAYFNDSQRQATKDAGKIAGL+VLRIINEPTAASLAYGFDKKANE+ILVFDLGGGTFDV
Sbjct: 178  VPAYFNDSQRQATKDAGKIAGLDVLRIINEPTAASLAYGFDKKANESILVFDLGGGTFDV 237

Query: 822  SVLEVGDGVFEVLSTSGDTHLGGDDFDKRIVDFLADDFKKSEGIDLRKDRQALQRLTEAA 1001
            SVLEVGDGVFEVLSTSGDTHLGGDDFDKRIVD++AD+F K+EGIDLRKDRQALQRLTEAA
Sbjct: 238  SVLEVGDGVFEVLSTSGDTHLGGDDFDKRIVDYMADEFNKNEGIDLRKDRQALQRLTEAA 297

Query: 1002 EKAKIELSGMAQTSINLPFITATADGPKHIDTQLTRAKFEEMCNDLLERCKVPVQQALRD 1181
            EKAK ELS + QTSINLPFITAT +GPKHIDTQL+R KFEE+C+DLL R K+PV+ ALRD
Sbjct: 298  EKAKCELSNLTQTSINLPFITATPEGPKHIDTQLSRVKFEELCSDLLSRAKIPVENALRD 357

Query: 1182 AKL 1190
            AKL
Sbjct: 358  AKL 360

 Score = 50.4 bits (119), Expect(2) = e-151
 Identities = 28/36 (77%), Positives = 29/36 (79%)
 Frame = +2

Query: 173 AGRAGVSRRALAVSVRAEKVVGIDLGTTNSAVAAME 280
           AGR     R  AV+VRAEKVVGIDLGTTNSAVAAME
Sbjct: 21  AGRRMPMSRRGAVAVRAEKVVGIDLGTTNSAVAAME 56

>gb|AAL66864.1| heat shock protein 70B [Dunaliella salina]
          Length = 669

 Score =  508 bits (1309), Expect(2) = e-151
 Identities = 259/303 (85%), Positives = 279/303 (91%), Gaps = 1/303 (0%)
 Frame = +3

Query: 285  GKPTIITNAEGGRTTPSVVAFTKTGDRLVGQIAKRQAVVNPENTFFSVKRFIGRRMSEVG 464
            GKPTII NAEG RTTPSVVAFTK GDRLVGQIAKRQAVVNPENTFFSVKRFIGR+  EVG
Sbjct: 58   GKPTIIANAEGSRTTPSVVAFTKGGDRLVGQIAKRQAVVNPENTFFSVKRFIGRKAGEVG 117

Query: 465  SESTQVPYRVIEDGG-NVKIKCPNAGKDFAPEEISAQVLRKLTEDAAKFLNDKVEKAVIT 641
             E+ QVPYRV+E    NVKI   +AGK+FAPEEIS+QVLRKLT DA+KFLNDKVEKAVIT
Sbjct: 118  EETKQVPYRVVEGSDRNVKIFSSHAGKEFAPEEISSQVLRKLTADASKFLNDKVEKAVIT 177

Query: 642  VPAYFNDSQRQATKDAGKIAGLEVLRIINEPTAASLAYGFDKKANETILVFDLGGGTFDV 821
            VPAYFNDSQRQATKDAGKIAGL+VLRIINEPTAASLAYGFDKKANE+ILVFDLGGGTFDV
Sbjct: 178  VPAYFNDSQRQATKDAGKIAGLDVLRIINEPTAASLAYGFDKKANESILVFDLGGGTFDV 237

Query: 822  SVLEVGDGVFEVLSTSGDTHLGGDDFDKRIVDFLADDFKKSEGIDLRKDRQALQRLTEAA 1001
            SVLEVGDGVFEVLSTSGDTHLGGDDFDKRIVD++AD+F K+EGIDLRKDRQALQRLTEAA
Sbjct: 238  SVLEVGDGVFEVLSTSGDTHLGGDDFDKRIVDYMADEFNKNEGIDLRKDRQALQRLTEAA 297

Query: 1002 EKAKIELSGMAQTSINLPFITATADGPKHIDTQLTRAKFEEMCNDLLERCKVPVQQALRD 1181
            EKAK ELS + QTSINLPFITAT +GPKHIDTQL+R KFEE+C+DLL R K+PV+ ALRD
Sbjct: 298  EKAKCELSNLTQTSINLPFITATPEGPKHIDTQLSRVKFEELCSDLLSRAKIPVENALRD 357

Query: 1182 AKL 1190
            AKL
Sbjct: 358  AKL 360

 Score = 50.4 bits (119), Expect(2) = e-151
 Identities = 28/36 (77%), Positives = 29/36 (79%)
 Frame = +2

Query: 173 AGRAGVSRRALAVSVRAEKVVGIDLGTTNSAVAAME 280
           AGR     R  AV+VRAEKVVGIDLGTTNSAVAAME
Sbjct: 21  AGRRMPMTRRGAVAVRAEKVVGIDLGTTNSAVAAME 56

>sp|Q02028|HS7S_PEA Stromal 70 kDa heat shock-related protein, chloroplast precursor
            gi|421881|pir||S32818 dnaK-type molecular chaperone CSS1
            precursor, chloroplast - garden pea
            gi|169023|gb|AAA33637.1| 70 kDa heat shock protein
            gi|871515|emb|CAA49147.1| Psst70 (stress 70 protein)
            [Pisum sativum]
          Length = 706

 Score =  496 bits (1277), Expect(2) = e-145
 Identities = 251/303 (82%), Positives = 277/303 (90%), Gaps = 1/303 (0%)
 Frame = +3

Query: 285  GKPTIITNAEGGRTTPSVVAFTKTGDRLVGQIAKRQAVVNPENTFFSVKRFIGRRMSEVG 464
            GKPTIITNAEG RTTPSVVA+TK GDRLVGQIAKRQAVVNPENTFFSVKRFIGR+MSEV 
Sbjct: 88   GKPTIITNAEGQRTTPSVVAYTKNGDRLVGQIAKRQAVVNPENTFFSVKRFIGRKMSEVD 147

Query: 465  SESTQVPYRVI-EDGGNVKIKCPNAGKDFAPEEISAQVLRKLTEDAAKFLNDKVEKAVIT 641
             ES QV YRVI +D GNVK+ CP  GK FA EEISAQVLRKL +DA+KFLNDKV KAV+T
Sbjct: 148  EESKQVSYRVIRDDNGNVKLDCPAIGKSFAAEEISAQVLRKLVDDASKFLNDKVTKAVVT 207

Query: 642  VPAYFNDSQRQATKDAGKIAGLEVLRIINEPTAASLAYGFDKKANETILVFDLGGGTFDV 821
            VPAYFNDSQR ATKDAG+IAGLEVLRIINEPTAASLAYGF++K NETILVFDLGGGTFDV
Sbjct: 208  VPAYFNDSQRTATKDAGRIAGLEVLRIINEPTAASLAYGFERKNNETILVFDLGGGTFDV 267

Query: 822  SVLEVGDGVFEVLSTSGDTHLGGDDFDKRIVDFLADDFKKSEGIDLRKDRQALQRLTEAA 1001
            SVLEVGDGVFEVLSTSGDTHLGGDDFDKR+VD+LA DFK+ EGIDL KD+QALQRLTE A
Sbjct: 268  SVLEVGDGVFEVLSTSGDTHLGGDDFDKRVVDWLAGDFKRDEGIDLLKDKQALQRLTETA 327

Query: 1002 EKAKIELSGMAQTSINLPFITATADGPKHIDTQLTRAKFEEMCNDLLERCKVPVQQALRD 1181
            EKAK+ELS ++QT+I+LPFITATADGPKHI+T LTRAKFEE+C+DLL+R + PV+ +LRD
Sbjct: 328  EKAKMELSSLSQTNISLPFITATADGPKHIETTLTRAKFEELCSDLLDRLRTPVENSLRD 387

Query: 1182 AKL 1190
            AKL
Sbjct: 388  AKL 390

 Score = 41.6 bits (96), Expect(2) = e-145
 Identities = 20/29 (68%), Positives = 24/29 (81%)
 Frame = +2

Query: 194 RRALAVSVRAEKVVGIDLGTTNSAVAAME 280
           ++   + V +EKVVGIDLGTTNSAVAAME
Sbjct: 58  KKGFTLRVVSEKVVGIDLGTTNSAVAAME 86

>ref|NP_194159.1| heat shock protein cpHsc70-1 [Arabidopsis thaliana]
            gi|7441883|pir||T09891 dnaK-type molecular chaperone
            T22A6.110 - Arabidopsis thaliana
            gi|5051770|emb|CAB45063.1| hsp 70-like protein
            [Arabidopsis thaliana] gi|7269278|emb|CAB79338.1| hsp
            70-like protein [Arabidopsis thaliana]
            gi|18175969|gb|AAL59960.1| putative hsp 70 protein
            [Arabidopsis thaliana] gi|25054945|gb|AAN71949.1|
            putative hsp 70 protein [Arabidopsis thaliana]
          Length = 718

 Score =  493 bits (1270), Expect(2) = e-144
 Identities = 249/303 (82%), Positives = 277/303 (91%), Gaps = 1/303 (0%)
 Frame = +3

Query: 285  GKPTIITNAEGGRTTPSVVAFTKTGDRLVGQIAKRQAVVNPENTFFSVKRFIGRRMSEVG 464
            GKPTI+TNAEG RTTPSVVA+TK+GDRLVGQIAKRQAVVNPENTFFSVKRFIGR+M+EV 
Sbjct: 98   GKPTIVTNAEGQRTTPSVVAYTKSGDRLVGQIAKRQAVVNPENTFFSVKRFIGRKMNEVD 157

Query: 465  SESTQVPYRVIED-GGNVKIKCPNAGKDFAPEEISAQVLRKLTEDAAKFLNDKVEKAVIT 641
             ES QV YRV+ D   NVK++CP   K FA EEISAQVLRKL +DA++FLNDKV KAVIT
Sbjct: 158  EESKQVSYRVVRDENNNVKLECPAINKQFAAEEISAQVLRKLVDDASRFLNDKVTKAVIT 217

Query: 642  VPAYFNDSQRQATKDAGKIAGLEVLRIINEPTAASLAYGFDKKANETILVFDLGGGTFDV 821
            VPAYFNDSQR ATKDAG+IAGLEVLRIINEPTAASLAYGFD+KANETILVFDLGGGTFDV
Sbjct: 218  VPAYFNDSQRTATKDAGRIAGLEVLRIINEPTAASLAYGFDRKANETILVFDLGGGTFDV 277

Query: 822  SVLEVGDGVFEVLSTSGDTHLGGDDFDKRIVDFLADDFKKSEGIDLRKDRQALQRLTEAA 1001
            SVLEVGDGVFEVLSTSGDTHLGGDDFDKR+VD+LA +FKK EGIDL KD+QALQRLTEAA
Sbjct: 278  SVLEVGDGVFEVLSTSGDTHLGGDDFDKRVVDWLAAEFKKDEGIDLLKDKQALQRLTEAA 337

Query: 1002 EKAKIELSGMAQTSINLPFITATADGPKHIDTQLTRAKFEEMCNDLLERCKVPVQQALRD 1181
            EKAKIELS + QT+++LPFITATADGPKHI+T LTRAKFEE+C+DLL+R + PV+ +LRD
Sbjct: 338  EKAKIELSSLTQTNMSLPFITATADGPKHIETTLTRAKFEELCSDLLDRVRTPVENSLRD 397

Query: 1182 AKL 1190
            AKL
Sbjct: 398  AKL 400

 Score = 42.4 bits (98), Expect(2) = e-144
 Identities = 25/33 (75%), Positives = 26/33 (78%), Gaps = 1/33 (3%)
 Frame = +2

Query: 185 GVSRRALA-VSVRAEKVVGIDLGTTNSAVAAME 280
           G SR A+  V V  EKVVGIDLGTTNSAVAAME
Sbjct: 64  GASRYAVGPVRVVNEKVVGIDLGTTNSAVAAME 96



EST assemble image


clone accession position
1 LCL020d06_r AV627055 1 454
2 LCL016f05_r AV626848 8 275
3 LCL084a06_r AV630765 9 486
4 LCL077h08_r AV630370 9 491
5 MXL044b03_r BP095578 11 405
6 LCL005g04_r AV626282 12 324
7 LCL012e08_r AV626627 12 420
8 MXL005c09_r BP093227 14 475
9 HCL056c03_r AV642698 16 508
10 HCL049g08_r AV642327 24 174
11 HCL054f03_r AV642606 26 461
12 LCL006h10_r AV626323 26 290
13 MXL002g09_r BP093060 26 459
14 LCL020h08_r AV627089 28 485
15 MXL019g06_r BP094223 33 420
16 MXL018g08_r BP094150 33 422
17 MXL041e05_r BP095421 35 163
18 MXL062b09_r BP096636 36 487
19 MXL048a06_r BP095828 36 456
20 MXL036c09_r BP095127 41 438
21 CL28a09_r AV394805 42 578
22 HCL040h06_r AV641822 55 452
23 HCL050h08_r AV642385 106 570
24 HCL001e07_r AV639591 147 364
25 LCL018a01_r AV626914 228 640
26 MXL011e01_r BP093648 488 646
27 MXL083g10_r BP097937 518 966
28 MXL002a07_r BP093002 520 911
29 MX010b03_r BP086493 663 1041
30 HC055b04_r AV636097 664 1116
31 MXL003b07_r BP093083 697 1144
32 LCL028c07_r AV627543 736 900
33 LCL053g02_r AV629176 776 1205
34 MXL023c08_r BP094455 870 1142
35 HCL004f04_r AV639764 990 1201




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research