KCC000422A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000422A_C01 KCC000422A_c01
gcacaatCTTCTATTCAGTGAGAGAAGATCTCTCCAAACGCTGAAGTTGTCCGACAGAAA
CACAAGCCCTGACCGTTTCTGGGGAGCTCTTCCAACCTTCATGAAGCAGTTAGCGAGTAT
TCACAGCCTCATTTACAAACTTGCGGAAAAGTTCGCAAGGGACGCAAAGTGGAAGCTGAG
CGCCTTCAAGGTGCTTGCCGAAGCCACGCCTAATCTGCGCGAGTTCACCCTCGCCGCATC
GGAAGATGTCCAGGTGGAGCTTCTCGATGCGCTTCTTAAAAGGCGGGGTGGAGGTGACGA
CTACTGCCCCAACGCGACAGACATGATGGAGGCTCTGCGTAGCGTACAGGTGCTGCCAGG
ACCTGGCGAGGTGCTGAAGCTCGGGGCCATCTCCTTTGTTCTCCACCCCGAGTATGATGC
GCTCTTTGTCCGAGAATGCTATCCGCACCTCTTTGAGGCTCTTGTGTGCAAGCCCGAGCC
CACGTTGTACATTGTCACGGGGACGCCCGGCATCGGAAAAAGCTGGTTCTTCTACTAC


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000422A_C01 KCC000422A_c01
         (538 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

gb|EAA41718.1| GLP_554_10058_10771 [Giardia lamblia ATCC 50803]        36  0.37
gb|AAL65627.1| transaldolase-like protein [Arabidopsis thaliana]...    35  0.82
gb|AAL65634.1| transaldolase-like protein [Arabidopsis thaliana]...    35  0.82
gb|AAL65624.1| transaldolase-like protein [Arabidopsis thaliana]...    34  1.1
gb|AAL65623.1| transaldolase-like protein [Arabidopsis thaliana]...    34  1.1

>gb|EAA41718.1| GLP_554_10058_10771 [Giardia lamblia ATCC 50803]
          Length = 237

 Score = 35.8 bits (81), Expect = 0.37
 Identities = 32/108 (29%), Positives = 48/108 (43%), Gaps = 6/108 (5%)
 Frame = -2

Query: 519 FPMPGVPVTMYNVGSGLHTRASKRCG*HSRTKSASYSGWRTKEMAPSFSTSPGPGST-CT 343
           F   G P    +   G  T +S RCG  +R+ S   +   + E  P    SP PGS+   
Sbjct: 7   FSSTGAPRGRCSAQCGYRTGSSSRCGPSTRSGSGLRAARSSPESTPRPQPSPTPGSSPAG 66

Query: 342 LRRASIMSVALGQ*SSPPPRLLRSASRS-----STWTSSDAARVNSRR 214
           LR  S+   +L    +P  R   S+  S     S  T+S ++R +S+R
Sbjct: 67  LRSRSLTRSSLRPSGAPTGRSQGSSGGSGGQAPSLRTASGSSRPSSQR 114

>gb|AAL65627.1| transaldolase-like protein [Arabidopsis thaliana]
           gi|22497322|gb|AAL65629.1| transaldolase-like protein
           [Arabidopsis thaliana] gi|22497324|gb|AAL65630.1|
           transaldolase-like protein [Arabidopsis thaliana]
           gi|22497326|gb|AAL65631.1| transaldolase-like protein
           [Arabidopsis thaliana]
          Length = 375

 Score = 34.7 bits (78), Expect = 0.82
 Identities = 27/78 (34%), Positives = 35/78 (44%)
 Frame = -2

Query: 429 TKSASYSGWRTKEMAPSFSTSPGPGSTCTLRRASIMSVALGQ*SSPPPRLLRSASRSSTW 250
           T SAS    R K +A  FS +P P    +LRR+              PR+L SAS SS+ 
Sbjct: 12  TLSASIQKGRWKTLAAGFSVTPLPAVNFSLRRSI-------------PRILASASSSSSP 58

Query: 249 TSSDAARVNSRRLGVASA 196
           +SS      +  L   SA
Sbjct: 59  SSSSLEAGENNELNAVSA 76

>gb|AAL65634.1| transaldolase-like protein [Arabidopsis thaliana]
           gi|22497334|gb|AAL65636.1| transaldolase-like protein
           [Arabidopsis thaliana]
          Length = 375

 Score = 34.7 bits (78), Expect = 0.82
 Identities = 27/78 (34%), Positives = 35/78 (44%)
 Frame = -2

Query: 429 TKSASYSGWRTKEMAPSFSTSPGPGSTCTLRRASIMSVALGQ*SSPPPRLLRSASRSSTW 250
           T SAS    R K +A  FS +P P    +LRR+              PR+L SAS SS+ 
Sbjct: 12  TLSASIQKGRWKTLAAGFSVTPLPAVNFSLRRSI-------------PRILASASSSSSP 58

Query: 249 TSSDAARVNSRRLGVASA 196
           +SS      +  L   SA
Sbjct: 59  SSSSLEAGENNELNAVSA 76

>gb|AAL65624.1| transaldolase-like protein [Arabidopsis thaliana]
           gi|22497316|gb|AAL65625.1| transaldolase-like protein
           [Arabidopsis thaliana]
          Length = 375

 Score = 34.3 bits (77), Expect = 1.1
 Identities = 27/78 (34%), Positives = 34/78 (42%)
 Frame = -2

Query: 429 TKSASYSGWRTKEMAPSFSTSPGPGSTCTLRRASIMSVALGQ*SSPPPRLLRSASRSSTW 250
           T SAS    R K +A  FS +P P    +LRR+              PR+L SAS SS+ 
Sbjct: 12  TLSASIQKGRWKTLAAGFSVTPLPAVNFSLRRSI-------------PRILASASSSSSP 58

Query: 249 TSSDAARVNSRRLGVASA 196
            SS      +  L   SA
Sbjct: 59  ASSSLEAGENNELNAVSA 76

>gb|AAL65623.1| transaldolase-like protein [Arabidopsis thaliana]
           gi|22497328|gb|AAL65632.1| transaldolase-like protein
           [Arabidopsis thaliana]
          Length = 375

 Score = 34.3 bits (77), Expect = 1.1
 Identities = 27/78 (34%), Positives = 34/78 (42%)
 Frame = -2

Query: 429 TKSASYSGWRTKEMAPSFSTSPGPGSTCTLRRASIMSVALGQ*SSPPPRLLRSASRSSTW 250
           T SAS    R K +A  FS +P P    +LRR+              PR+L SAS SS+ 
Sbjct: 12  TLSASIQKGRWKTLAAGFSVTPLPAVNFSLRRSI-------------PRILASASSSSSP 58

Query: 249 TSSDAARVNSRRLGVASA 196
            SS      +  L   SA
Sbjct: 59  ASSSLEAGENNELNAVSA 76



EST assemble image


clone accession position
1 HCL057h07_r AV642786 1 537
2 LCL010f02_r AV626524 8 421
3 CL27h06_r AV394693 23 539
4 HCL097a11_r AV645019 26 371
5 LCL043e01_r AV628538 46 403




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research