KCC000420A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000420A_C01 KCC000420A_c01
ttgtatgacagccatttAGTATCCAGCGTGCACCTACAGCTAACTTTTCTTGCACGGTCT
CCGCGCGCAAGCGTTTCCTGCTCCACGAACCTCTGCGTTGCCTGGGCGCAGGAGCGCTGC
GATGAGTGGCTCAGAACCCGATGTAGAGGAGGCAGGCAAGGTAGTCACGGAGTCGCAAGC
AAAGCGGCAGGCGTCCGTCTCGTCGAAAGATGGCGCCGTGAAGCCCAACGCCATCGCAAA
GCATCCCGCAACCATCACCGAGAAGCAAATCGAGATGGGAGCCTTCAAGCGCTTCATTTC
AGGTCCCTACTTTGACGTCATCCCCTCCCAGTATGAGCACGTCACGACTTCGCGCGCACA
CAAGGCGCGACTGCAGCTGAAGGCCGAGACTCTGCCGGCGCCCGGCACCGAGGCCCACGG
CGACGGCTGTGGCGATGAGAAGCCACACGACGCCAAGCTGGATGCGCAGCTCAAGGCTCT
GGAAGAGGAGGACTACCTGGGTCGCCTCAAGCGAATCGTGACAACCAAGGCTGACACCGA
CGGCGTGTACGGGCTTACGTATGAGG


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000420A_C01 KCC000420A_c01
         (566 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

emb|CAC36180.1| 65 kDa heat shock protein [Mycobacterium terrae]       43  0.003
emb|CAC35959.1| type II 65 kDa heat shock protein [Mycobacterium...    42  0.004
ref|NP_005830.1| Ser/Arg-related nuclear matrix protein (plenty ...    42  0.006
gb|AAH36187.1| SRRM1 protein [Homo sapiens]                            42  0.006
ref|XP_293372.2| similar to Ser/Arg-related nuclear matrix prote...    39  0.038

>emb|CAC36180.1| 65 kDa heat shock protein [Mycobacterium terrae]
          Length = 146

 Score = 43.1 bits (100), Expect = 0.003
 Identities = 41/120 (34%), Positives = 52/120 (43%), Gaps = 1/120 (0%)
 Frame = +3

Query: 195 PSRRKMAP*SPTPSQSIPQPSPRS-KSRWEPSSASFQVPTLTSSPPSMSTSRLRAHTRRD 371
           PS  K +P  PT S     P P     RW   + +   P  T  P S ++ R    + R 
Sbjct: 22  PSWSKRSPRRPTMSPVTAPPRPPCWHRRWSRKACATWPPAPTRWPXSAASRRPSRRSPRP 81

Query: 372 CS*RPRLCRRPAPRPTATAVAMRSHTTPSWMRSSRLWKRRTTWVASSES*QPRLTPTACT 551
           C   PR   RP  R      + R+ T+PS   S R W R  T V SS S  P  TP+AC+
Sbjct: 82  CXRTPRR-SRPRSRSRLPPGSPRA-TSPSVTXSPRRWTRSATKV-SSPSRSP--TPSACS 136

 Score = 38.1 bits (87), Expect = 0.084
 Identities = 27/77 (35%), Positives = 36/77 (46%)
 Frame = +3

Query: 183 SGRRPSRRKMAP*SPTPSQSIPQPSPRSKSRWEPSSASFQVPTLTSSPPSMSTSRLRAHT 362
           + RRPSRR   P   TP +S     PRS+SR  P S     P++T SP   + S  +  +
Sbjct: 70  ASRRPSRRSPRPCXRTPRRS----RPRSRSRLPPGSPRATSPSVTXSPRRWTRSATKV-S 124

Query: 363 RRDCS*RPRLCRRPAPR 413
               S  P  C   +PR
Sbjct: 125 SPSRSPTPSACSWSSPR 141

>emb|CAC35959.1| type II 65 kDa heat shock protein [Mycobacterium abscessus]
          Length = 146

 Score = 42.4 bits (98), Expect = 0.004
 Identities = 41/121 (33%), Positives = 50/121 (40%), Gaps = 4/121 (3%)
 Frame = +3

Query: 216 P*SPTPSQ-SIPQPSPRSKSRWEPSSASFQVPTLTSSPPSMSTSRLRAHTRRDCS*RPRL 392
           P  PT S+ + P P P S   W         P  T S  S  + R    + R C   PR 
Sbjct: 29  PRRPTTSRVTAPPPPPCSPRLWSRKVCVTSPPAPTRSAXSAVSRRPSRRSPRRCXRAPRR 88

Query: 393 CR---RPAPRPTATAVAMRSHTTPSWMRSSRLWKRRTTWVASSES*QPRLTPTACTGLRM 563
            R   R  PRP +        T+PS   S R W R  T V SS S  P  TP+AC+ +  
Sbjct: 89  SRPRSRSRPRPVSPRA-----TSPSATXSPRPWTRLVTRV-SSPSRSP--TPSACSWISP 140

Query: 564 R 566
           R
Sbjct: 141 R 141

>ref|NP_005830.1| Ser/Arg-related nuclear matrix protein (plenty of prolines 101-l;
           Ser/Arg-related nuclear matrix protein (plenty of
           prolines 101-like) [Homo sapiens]
           gi|3005587|gb|AAC09321.1| Ser/Arg-related nuclear matrix
           protein [Homo sapiens]
           gi|33150824|gb|AAP97290.1|AF419855_1 Ser/Arg-related
           nuclear matrix protein [Homo sapiens]
          Length = 820

 Score = 42.0 bits (97), Expect = 0.006
 Identities = 37/114 (32%), Positives = 48/114 (41%)
 Frame = +3

Query: 168 RSRKQSGRRPSRRKMAP*SPTPSQSIPQPSPRSKSRWEPSSASFQVPTLTSSPPSMSTSR 347
           R R  S   P RR+  P +P P +  P P PR +S   PS   +  P      PS     
Sbjct: 555 RRRSPSPAPPPRRRRTP-TPPPRRRTPSPPPRRRS---PSPRRYSPPIQRRYSPSPPPK- 609

Query: 348 LRAHTRRDCS*RPRLCRRPAPRPTATAVAMRSHTTPSWMRSSRLWKRRTTWVAS 509
                RR  S  P   RR +P P        SH+ P   RSS + KRR+  ++S
Sbjct: 610 -----RRTASPPPPPKRRASPSPPPKRRV--SHSPPPKQRSSPVTKRRSPSLSS 656

 Score = 40.0 bits (92), Expect = 0.022
 Identities = 40/138 (28%), Positives = 63/138 (44%), Gaps = 15/138 (10%)
 Frame = +3

Query: 129 AQNPM*RRQAR*SRSRKQSG--RRPS-RRKMAP*SPTPSQSIPQPSPRSKSRWEPSSASF 299
           +++P   R  R  RS K     RRPS RR+ +P   TP + +P P    +SR        
Sbjct: 290 SRSPSHTRPRRRHRSDKMYSPRRRPSPRRRPSPRRRTPPRRMPPPPRHRRSRSPVRRRRR 349

Query: 300 QVPTLTSSPPSMSTSRLRAHTRRD---CS*RPRLCRRPAP---------RPTATAVAMRS 443
              +L+ S  S S+SR R+  ++     S  PR  RR +P         RP+  A   ++
Sbjct: 350 SSASLSGSSSSSSSSRSRSPPKKPPKRTSSPPRKTRRLSPSASPPRRRHRPSPPATPPKT 409

Query: 444 HTTPSWMRSSRLWKRRTT 497
             +P+  +S+R  K R +
Sbjct: 410 RDSPTPQQSNRTRKSRVS 427

 Score = 36.6 bits (83), Expect = 0.24
 Identities = 26/102 (25%), Positives = 40/102 (38%), Gaps = 5/102 (4%)
 Frame = +3

Query: 132 QNPM*RRQAR*SRSRKQSGRRPSRRKMAP*SPTPSQSIPQPSPRSKSRWEPSSASFQVPT 311
           ++P  RR +   + R      P RR  +P  P   ++ P P P+ +    P       P 
Sbjct: 587 RSPSPRRYSPPIQRRYSPSPPPKRRTASPPPPPKRRASPSPPPKRRVSHSPPPKQRSSPV 646

Query: 312 LTSSPPSMSTSRLRA-----HTRRDCS*RPRLCRRPAPRPTA 422
                PS+S+   +       TR   S +P     P+PRP A
Sbjct: 647 TKRRSPSLSSKHRKGSSPSRSTREARSPQPNKRHSPSPRPRA 688

 Score = 32.3 bits (72), Expect = 4.6
 Identities = 31/108 (28%), Positives = 45/108 (40%), Gaps = 3/108 (2%)
 Frame = +3

Query: 159 R*SRSRKQSGRRPSRRKMAP*---SPTPSQSIPQPSPRSKSRWEPSSASFQVPTLTSSPP 329
           R  RS  ++G    RR+ +P    SP+P +   + SPR + R  PS      PT     P
Sbjct: 504 RPKRSHVKNGEVGRRRRHSPSRSASPSPRKRQKETSPRGRRRRSPSPP----PTRRRRSP 559

Query: 330 SMSTSRLRAHTRRDCS*RPRLCRRPAPRPTATAVAMRSHTTPSWMRSS 473
           S +    R  T       P   R P+P P   + + R ++ P   R S
Sbjct: 560 SPAPPPRRRRTPTP----PPRRRTPSPPPRRRSPSPRRYSPPIQRRYS 603

>gb|AAH36187.1| SRRM1 protein [Homo sapiens]
          Length = 904

 Score = 42.0 bits (97), Expect = 0.006
 Identities = 37/114 (32%), Positives = 48/114 (41%)
 Frame = +3

Query: 168 RSRKQSGRRPSRRKMAP*SPTPSQSIPQPSPRSKSRWEPSSASFQVPTLTSSPPSMSTSR 347
           R R  S   P RR+  P +P P +  P P PR +S   PS   +  P      PS     
Sbjct: 557 RRRSPSPAPPPRRRRTP-TPPPRRRTPSPPPRRRS---PSPRRYSPPIQRRYSPSPPPK- 611

Query: 348 LRAHTRRDCS*RPRLCRRPAPRPTATAVAMRSHTTPSWMRSSRLWKRRTTWVAS 509
                RR  S  P   RR +P P        SH+ P   RSS + KRR+  ++S
Sbjct: 612 -----RRTASPPPPPKRRASPSPPPKRRV--SHSPPPKQRSSPVTKRRSPSLSS 658

 Score = 37.4 bits (85), Expect = 0.14
 Identities = 41/140 (29%), Positives = 65/140 (46%), Gaps = 17/140 (12%)
 Frame = +3

Query: 129 AQNPM*RRQAR*SRSRKQS---GRRPS-RRKMAP*SPTPSQSIPQPSPRSKSRWEPSSAS 296
           +++P   R  R  RSR +S    RRPS RR+ +P   TP + +P P    +SR       
Sbjct: 290 SRSPSHTRPRRRHRSRSRSYSPRRRPSPRRRPSPRRRTPPRRMPPPPRHRRSRSPVRRRR 349

Query: 297 FQVPTLTSSPPSMSTSRLRAHTRRD---CS*RPRLCRRPAP---------RPTATAV-AM 437
               +L+ S  S S+SR R+  ++     S  PR  RR +P         RP+  A    
Sbjct: 350 RSSASLSGSSSSSSSSRSRSPPKKPPKRTSSPPRKTRRLSPSASPPRRRHRPSPPATPPP 409

Query: 438 RSHTTPSWMRSSRLWKRRTT 497
           ++  +P+  +S+R  K R +
Sbjct: 410 KTRHSPTPQQSNRTRKSRVS 429

 Score = 36.6 bits (83), Expect = 0.24
 Identities = 26/102 (25%), Positives = 40/102 (38%), Gaps = 5/102 (4%)
 Frame = +3

Query: 132 QNPM*RRQAR*SRSRKQSGRRPSRRKMAP*SPTPSQSIPQPSPRSKSRWEPSSASFQVPT 311
           ++P  RR +   + R      P RR  +P  P   ++ P P P+ +    P       P 
Sbjct: 589 RSPSPRRYSPPIQRRYSPSPPPKRRTASPPPPPKRRASPSPPPKRRVSHSPPPKQRSSPV 648

Query: 312 LTSSPPSMSTSRLRA-----HTRRDCS*RPRLCRRPAPRPTA 422
                PS+S+   +       TR   S +P     P+PRP A
Sbjct: 649 TKRRSPSLSSKHRKGSSPSRSTREARSPQPNKRHSPSPRPRA 690

 Score = 32.3 bits (72), Expect = 4.6
 Identities = 31/108 (28%), Positives = 45/108 (40%), Gaps = 3/108 (2%)
 Frame = +3

Query: 159 R*SRSRKQSGRRPSRRKMAP*---SPTPSQSIPQPSPRSKSRWEPSSASFQVPTLTSSPP 329
           R  RS  ++G    RR+ +P    SP+P +   + SPR + R  PS      PT     P
Sbjct: 506 RPKRSHVKNGEVGRRRRHSPSRSASPSPRKRQKETSPRGRRRRSPSPP----PTRRRRSP 561

Query: 330 SMSTSRLRAHTRRDCS*RPRLCRRPAPRPTATAVAMRSHTTPSWMRSS 473
           S +    R  T       P   R P+P P   + + R ++ P   R S
Sbjct: 562 SPAPPPRRRRTPTP----PPRRRTPSPPPRRRSPSPRRYSPPIQRRYS 605

>ref|XP_293372.2| similar to Ser/Arg-related nuclear matrix protein (plenty of
           prolines 101-l; Ser/Arg-related nuclear matrix protein
           (plenty of prolines 101-like) [Homo sapiens]
          Length = 429

 Score = 39.3 bits (90), Expect = 0.038
 Identities = 35/116 (30%), Positives = 48/116 (41%), Gaps = 2/116 (1%)
 Frame = +3

Query: 168 RSRKQSGRRPSRRK--MAP*SPTPSQSIPQPSPRSKSRWEPSSASFQVPTLTSSPPSMST 341
           R R+     P+RR+  ++P  P    S P P PR ++   PS      P   S P     
Sbjct: 294 RQRRTPSPPPTRRRWSLSPAPPPRGHSSPTPPPRKRTPSPPSHRCSPSPRRYSPPIQRRY 353

Query: 342 SRLRAHTRRDCS*RPRLCRRPAPRPTATAVAMRSHTTPSWMRSSRLWKRRTTWVAS 509
           S      RR  S  P   +R  P P        SH+ P   RSS + KRR+  ++S
Sbjct: 354 SPSPPPKRRMASSPPLPEQRALPSPPPKHWV--SHSPPPKQRSSSVTKRRSPSLSS 407



EST assemble image


clone accession position
1 LCL040f09_r AV628368 1 341
2 LCL036g12_r AV628108 18 518
3 CL48a03_r AV395806 23 555
4 LCL008h03_r AV626427 23 475
5 LCL092d09_r AV631348 23 424
6 LCL095c12_r AV631512 29 541
7 CL56g03_r AV396092 34 492
8 CL27f04_r AV394719 34 566
9 CL77g03_r AV397255 39 555
10 HCL029g02_r AV641205 49 527
11 HCL039f10_r AV641745 49 562
12 CL39a11_r AV395213 49 460




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research