KCC000419A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000419A_C01 KCC000419A_c01
tagaTGGATTAACCATGGCGCTGCAGCAGGCTGCGCCGAGGGTGTTCGGCCTCTTGGGGC
GTGCCCCCGTCGCTCTGGGCCAGAGCGGCATTCTGACTGGTAGCAGCGGCTTCAAGAACC
AGGGATTCAACGGCTCCCTGCAGTCTGTGGAGAACCATGTGTATGCCCAGGCCTTCAGCA
CCTCTTCTCAGGAGGAGCAGGCTGCTCCCAGCATTCAGGGTGCTTCGGGCATGAAGCTGC
CTGGTATGGCTGGTAGCATGCTGCTTGGCAAGTCGCGCAGCGGCCTGCGCACCGGCTCGA
TGGTGCCATTCGCTGCCCAGCAGGCGATGAACATGTCGACGGCCGCCCAGGTGCAGTCGG
GCGCCACCGTGAACTCCCTGCTGCTCGGCATCTACCGCTTCTGGCGCAGCCAGGCGCCCA
TGGATAAGCCGCACGCGCCCGTGGATGACCGCATGCTCCCCGCCATTGTGGATGCTAGCG
ACAACCGCGCGGCCCTGGGAACCTGGGCCACCGCCCTGTTCTGCACCATCCTGGCCTCCA
ACTTGCTGGGTCTGGTGCCCACCAACGAGGCGCCCACCTCCGGCCTGGGCTTCGCCACCG
GCCTGGGTGTGAGCGTGTGGGCCACCGCCACCACCCTGGGTCTGTACAAGCTGGGCTTCT
CCTTCCCCGGGCACTTCATCCCTGGCGGCACCCCCTGGCCCATGGCCTTCATCTTCGTGC
CCCTGGAGACCATTTCGTACACCTTCCGTGCTGTTTCCCTGGGTGTCCGTCTGTGGGTCA
ACATGCTGGCCGGACACACGCTGCTGCACATTCTGACGGGCATGGCGCTGGCGCTGCCTT
TCTCGCTGTCGTTCTTCGCCATGGTGCCCGCCACCTTCGCCGTCGCCTGCCTGCTGTCGG
CGCTGGTGGGCCTGGAGTACCTGGTGGCGGTGCTGCAGTCGGGTGTGTTCTCCATCCTGT
CCACCGTCTACGTTGGCGAGTTCAACAGCGTCAAGCTGGCGGGCCCGCTGGCTAAGGTGG
TCAAGAAGGCGCTGTAAGCGGCCTCGGAATGGGACGGCGTGACGCCGTGCGGAGCCTGTG
CAGCTGGCGCAGCCGGGCGGCTGAGCAGCGGCTGATGGCGGCTGCGGCTGGCTTACGGAG
GGCGCAGTTGCGGCAGGAGGTGCTGTGGCGGCGGCGTAGCGCGGGGTAGCGTACAACAGC
GGGAACAGGGCGCGGCCCGGCGGTGCTAGTCGGCAGATACACCGGCGCAGTGCTTTCCGG
GCCTGCTCGGGCAGAAGTGCGGGTTGGTGTAGCCAGTAAGAGCATGGGGGTGCGGCTTGC
GCCGGCCGTGGGGTTTCCCGCGGCACTGGTGGCAGCGGTCGGCTGAGTCGCCTAGATGTT
GCTTTGTCTCGTGTCGGGGCGTCCGCTGCGTGGAGGGGCGGTGCCTGCGCCTGCGCGGGA
TGGCGTCAGTCGGGGAGCTGCGCGGATTAGAGGTATGCGGCGGCAGCGGCGACGTCGATA
GCAGTAGCAGAGGAGCGGAGCTGTGGAGTTGGAGAGCGGCTGCCAGCGGCGCAGGGCGTC
GTCATGTCGCCCGCCTGCGTATCCCCC


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000419A_C01 KCC000419A_c01
         (1587 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

gb|AAL79815.1|AF411119_1 ATP synthase F1F0 subunit 6 [Chlamydomo...   665  0.0
gb|AAN70986.1|AF388174_1 ATP synthase subunit 6 [Chlamydomonas r...   660  0.0
gb|AAL35726.1| ATP synthase subunit 6 [Chlamydomonas reinhardtii]     656  0.0
gb|AAF72060.1|AF204057_15 ATP synthase F0 subunit 6 [Scenedesmus...   137  7e-31
ref|NP_057983.1| ATPase subunit 6 [Scenedesmus obliquus] gi|7711...   137  7e-31

>gb|AAL79815.1|AF411119_1 ATP synthase F1F0 subunit 6 [Chlamydomonas reinhardtii]
            gi|18874450|gb|AAL79816.1|AF411921_1 ATP synthase F1F0
            subunit 6 [Chlamydomonas reinhardtii]
          Length = 340

 Score =  665 bits (1715), Expect = 0.0
 Identities = 340/340 (100%), Positives = 340/340 (100%)
 Frame = +3

Query: 15   MALQQAAPRVFGLLGRAPVALGQSGILTGSSGFKNQGFNGSLQSVENHVYAQAFSTSSQE 194
            MALQQAAPRVFGLLGRAPVALGQSGILTGSSGFKNQGFNGSLQSVENHVYAQAFSTSSQE
Sbjct: 1    MALQQAAPRVFGLLGRAPVALGQSGILTGSSGFKNQGFNGSLQSVENHVYAQAFSTSSQE 60

Query: 195  EQAAPSIQGASGMKLPGMAGSMLLGKSRSGLRTGSMVPFAAQQAMNMSTAAQVQSGATVN 374
            EQAAPSIQGASGMKLPGMAGSMLLGKSRSGLRTGSMVPFAAQQAMNMSTAAQVQSGATVN
Sbjct: 61   EQAAPSIQGASGMKLPGMAGSMLLGKSRSGLRTGSMVPFAAQQAMNMSTAAQVQSGATVN 120

Query: 375  SLLLGIYRFWRSQAPMDKPHAPVDDRMLPAIVDASDNRAALGTWATALFCTILASNLLGL 554
            SLLLGIYRFWRSQAPMDKPHAPVDDRMLPAIVDASDNRAALGTWATALFCTILASNLLGL
Sbjct: 121  SLLLGIYRFWRSQAPMDKPHAPVDDRMLPAIVDASDNRAALGTWATALFCTILASNLLGL 180

Query: 555  VPTNEAPTSGLGFATGLGVSVWATATTLGLYKLGFSFPGHFIPGGTPWPMAFIFVPLETI 734
            VPTNEAPTSGLGFATGLGVSVWATATTLGLYKLGFSFPGHFIPGGTPWPMAFIFVPLETI
Sbjct: 181  VPTNEAPTSGLGFATGLGVSVWATATTLGLYKLGFSFPGHFIPGGTPWPMAFIFVPLETI 240

Query: 735  SYTFRAVSLGVRLWVNMLAGHTLLHILTGMALALPFSLSFFAMVPATFAVACLLSALVGL 914
            SYTFRAVSLGVRLWVNMLAGHTLLHILTGMALALPFSLSFFAMVPATFAVACLLSALVGL
Sbjct: 241  SYTFRAVSLGVRLWVNMLAGHTLLHILTGMALALPFSLSFFAMVPATFAVACLLSALVGL 300

Query: 915  EYLVAVLQSGVFSILSTVYVGEFNSVKLAGPLAKVVKKAL 1034
            EYLVAVLQSGVFSILSTVYVGEFNSVKLAGPLAKVVKKAL
Sbjct: 301  EYLVAVLQSGVFSILSTVYVGEFNSVKLAGPLAKVVKKAL 340

>gb|AAN70986.1|AF388174_1 ATP synthase subunit 6 [Chlamydomonas reinhardtii]
          Length = 340

 Score =  660 bits (1703), Expect = 0.0
 Identities = 338/340 (99%), Positives = 338/340 (99%)
 Frame = +3

Query: 15   MALQQAAPRVFGLLGRAPVALGQSGILTGSSGFKNQGFNGSLQSVENHVYAQAFSTSSQE 194
            MALQQAAPRVFGLLGRAPVALGQSGILTGSSGFKNQGFNGSLQSVENHVYAQAFSTSSQE
Sbjct: 1    MALQQAAPRVFGLLGRAPVALGQSGILTGSSGFKNQGFNGSLQSVENHVYAQAFSTSSQE 60

Query: 195  EQAAPSIQGASGMKLPGMAGSMLLGKSRSGLRTGSMVPFAAQQAMNMSTAAQVQSGATVN 374
            EQAAPSIQGASGMKLPGMAGSMLLGKSRSGLRTGSMVPFAAQQAMNMSTAAQVQSGATVN
Sbjct: 61   EQAAPSIQGASGMKLPGMAGSMLLGKSRSGLRTGSMVPFAAQQAMNMSTAAQVQSGATVN 120

Query: 375  SLLLGIYRFWRSQAPMDKPHAPVDDRMLPAIVDASDNRAALGTWATALFCTILASNLLGL 554
            SLLLGIYRFWRSQAPMDKPHAPVDDRMLPAIVDASDN AALGTWATALFCTILASNLLGL
Sbjct: 121  SLLLGIYRFWRSQAPMDKPHAPVDDRMLPAIVDASDNCAALGTWATALFCTILASNLLGL 180

Query: 555  VPTNEAPTSGLGFATGLGVSVWATATTLGLYKLGFSFPGHFIPGGTPWPMAFIFVPLETI 734
            VPTNEAPTSGLGFATGLGVSVW TATTLGLYKLGFSFPGHFIPGGTPWPMAFIFVPLETI
Sbjct: 181  VPTNEAPTSGLGFATGLGVSVWVTATTLGLYKLGFSFPGHFIPGGTPWPMAFIFVPLETI 240

Query: 735  SYTFRAVSLGVRLWVNMLAGHTLLHILTGMALALPFSLSFFAMVPATFAVACLLSALVGL 914
            SYTFRAVSLGVRLWVNMLAGHTLLHILTGMALALPFSLSFFAMVPATFAVACLLSALVGL
Sbjct: 241  SYTFRAVSLGVRLWVNMLAGHTLLHILTGMALALPFSLSFFAMVPATFAVACLLSALVGL 300

Query: 915  EYLVAVLQSGVFSILSTVYVGEFNSVKLAGPLAKVVKKAL 1034
            EYLVAVLQSGVFSILSTVYVGEFNSVKLAGPLAKVVKKAL
Sbjct: 301  EYLVAVLQSGVFSILSTVYVGEFNSVKLAGPLAKVVKKAL 340

>gb|AAL35726.1| ATP synthase subunit 6 [Chlamydomonas reinhardtii]
          Length = 340

 Score =  656 bits (1693), Expect = 0.0
 Identities = 337/340 (99%), Positives = 339/340 (99%)
 Frame = +3

Query: 15   MALQQAAPRVFGLLGRAPVALGQSGILTGSSGFKNQGFNGSLQSVENHVYAQAFSTSSQE 194
            MALQQAAPRVFGLLGRAPVALGQSGILTGSSGFKNQGFNGSLQSVENHVYAQAFSTSSQE
Sbjct: 1    MALQQAAPRVFGLLGRAPVALGQSGILTGSSGFKNQGFNGSLQSVENHVYAQAFSTSSQE 60

Query: 195  EQAAPSIQGASGMKLPGMAGSMLLGKSRSGLRTGSMVPFAAQQAMNMSTAAQVQSGATVN 374
            EQAAPSIQGASG+KLPGMAGS+LLGKSRSGLRTGSMVPFAAQQAMNMSTAAQVQSGATVN
Sbjct: 61   EQAAPSIQGASGIKLPGMAGSILLGKSRSGLRTGSMVPFAAQQAMNMSTAAQVQSGATVN 120

Query: 375  SLLLGIYRFWRSQAPMDKPHAPVDDRMLPAIVDASDNRAALGTWATALFCTILASNLLGL 554
            SLLLGIYRFWRSQAPMDKPHAPVDDRMLPAIVDASDNRAALGTWATALFCTILASNLLGL
Sbjct: 121  SLLLGIYRFWRSQAPMDKPHAPVDDRMLPAIVDASDNRAALGTWATALFCTILASNLLGL 180

Query: 555  VPTNEAPTSGLGFATGLGVSVWATATTLGLYKLGFSFPGHFIPGGTPWPMAFIFVPLETI 734
            VPTNEAPTSGLGFATGLGVSVWATATTLGLYKLGFSFPGHFIPGGTP PMAFIFVPLETI
Sbjct: 181  VPTNEAPTSGLGFATGLGVSVWATATTLGLYKLGFSFPGHFIPGGTPRPMAFIFVPLETI 240

Query: 735  SYTFRAVSLGVRLWVNMLAGHTLLHILTGMALALPFSLSFFAMVPATFAVACLLSALVGL 914
            SYTFRAVSLGVRLWVNMLAGHTLLHILTGMALALPFSLSFFAMVPATFAVACLLSALVGL
Sbjct: 241  SYTFRAVSLGVRLWVNMLAGHTLLHILTGMALALPFSLSFFAMVPATFAVACLLSALVGL 300

Query: 915  EYLVAVLQSGVFSILSTVYVGEFNSVKLAGPLAKVVKKAL 1034
            EYLVAVLQSGVFSILSTVYVGEFNSVKLAGPLAKVVKKAL
Sbjct: 301  EYLVAVLQSGVFSILSTVYVGEFNSVKLAGPLAKVVKKAL 340

>gb|AAF72060.1|AF204057_15 ATP synthase F0 subunit 6 [Scenedesmus obliquus]
          Length = 304

 Score =  137 bits (344), Expect = 7e-31
 Identities = 74/159 (46%), Positives = 95/159 (59%)
 Frame = +3

Query: 504 WATALFCTILASNLLGLVPTNEAPTSGLGFATGLGVSVWATATTLGLYKLGFSFPGHFIP 683
           W++ LF  +LASN  GLVP   A T   GF  G+ + + +  T LG+ + G  F   F+P
Sbjct: 134 WSSVLFFILLASNSFGLVPLCSAITGQAGFTLGMSIRLLSGITYLGVKRQGMRFVRLFLP 193

Query: 684 GGTPWPMAFIFVPLETISYTFRAVSLGVRLWVNMLAGHTLLHILTGMALALPFSLSFFAM 863
            G  WPMA +F+ LE+ISY FRA+SLG RL+ NM AGH LLH+ T ++L           
Sbjct: 194 SGPSWPMAPLFILLESISYGFRAISLGTRLYCNMFAGHLLLHLFTSLSLVPVLCTPVLLG 253

Query: 864 VPATFAVACLLSALVGLEYLVAVLQSGVFSILSTVYVGE 980
            P T   A +L AL  LE +VAVLQSGVF +LS  YV E
Sbjct: 254 APFTVIAASILMALSALETIVAVLQSGVFCLLSGFYVTE 292

>ref|NP_057983.1| ATPase subunit 6 [Scenedesmus obliquus] gi|7711044|emb|CAB90368.1|
           ATPase subunit 6 [Scenedesmus obliquus]
          Length = 253

 Score =  137 bits (344), Expect = 7e-31
 Identities = 74/159 (46%), Positives = 95/159 (59%)
 Frame = +3

Query: 504 WATALFCTILASNLLGLVPTNEAPTSGLGFATGLGVSVWATATTLGLYKLGFSFPGHFIP 683
           W++ LF  +LASN  GLVP   A T   GF  G+ + + +  T LG+ + G  F   F+P
Sbjct: 83  WSSVLFFILLASNSFGLVPLCSAITGQAGFTLGMSIRLLSGITYLGVKRQGMRFVRLFLP 142

Query: 684 GGTPWPMAFIFVPLETISYTFRAVSLGVRLWVNMLAGHTLLHILTGMALALPFSLSFFAM 863
            G  WPMA +F+ LE+ISY FRA+SLG RL+ NM AGH LLH+ T ++L           
Sbjct: 143 SGPSWPMAPLFILLESISYGFRAISLGTRLYCNMFAGHLLLHLFTSLSLVPVLCTPVLLG 202

Query: 864 VPATFAVACLLSALVGLEYLVAVLQSGVFSILSTVYVGE 980
            P T   A +L AL  LE +VAVLQSGVF +LS  YV E
Sbjct: 203 APFTVIAASILMALSALETIVAVLQSGVFCLLSGFYVTE 241



EST assemble image


clone accession position
1 HCL054d05_r AV642595 1 597
2 LC047b07_r AV622019 65 527
3 LCL070c03_r AV629970 67 430
4 LC050e09_r AV622504 69 571
5 MXL056c01_r BP096299 73 472
6 CL42e03_r AV395475 80 575
7 LCL025g10_r AV627373 80 490
8 HCL042a06_r AV641894 80 497
9 CM024a10_r AV388269 86 660
10 MXL011g08_r BP093668 101 432
11 HCL071g07_r AV643563 156 625
12 LCL097f01_r AV631651 270 617
13 CL27c05_r AV394701 460 943
14 LC063h03_r AV623443 514 1011
15 MX260c01_r BP092869 527 931
16 LC035g06_r AV621415 857 1195
17 CM003e06_r AV386579 1048 1515
18 CM065e07_r AV391152 1110 1719




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research