KCC000418A_c02
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000418A_C02 KCC000418A_c02
GTAGACTCCGCCCCTCACAGCCTCCATCGAGAGAAATGGCGTCCTCCCAGAAGGCTGTGC
AGATGTCGCTGGGCGCTGTGCGCTCTCTGAGCACCGGCATGGCCCGCCTGCAGGCGGCCT
CGGCCCAGGGCATGCTGGCGTCCAGCCAGGGTGCGGCGGGCCAGATGGAGAAGCCCGTGA
TGGTGGCCACCCAGGTCCCCATTCTGGGCGCCTCTCCCTCGGCGATCGCTAGCGGCATCC
GCGCTTCCGCGAAGGCCTCTCCCATGTCGCTGGCCCCTCAGCGCTCCATGAGCGTGCTGG
CTGCCTCCAAGATGGTGGGCGCTGGCTGCGCTACCATCGCCCTGGCGGGTGTCGGAGCCG
GTCTGGGCGTGATGTTTGGCTCGCTCATCAACGGCGCTGCCCGCAACCCCAACATTGCTA
AGCAGCTGGTCGGCTACGCTCTGCTGGGCTTCGCCCTGACGGAGTCTATTGCGCTGTTCT
CGCTGCTGGTGGTGTTCCTGATTCTGTTCGCTTAGATGGTATCACTTCTCGGCGGCTGGA
GCGGCGAGCTTTCGGACAGATTCGCGGAGCTCTCGGACTCGGGGGTGGCGCGGAGCTGGA
GGAGCGGTCTCGGGTTGGGACCAGGGGCTTACGTGTGTGTATTAGGGCACCGTGTCGGGG
TGGAAGCCCCACACGCGGTACAACCCGTGTGACACGGATTTAGAATAGATGTGCTTAACA
ACATGCGAATGTGTGAGTTGCTGAGCGTGCACTCGAGGAGGTTGCCATGTGGCGGGCATG
GGACACAGGGCGTGTCGCGCGATGGCAGAATGGCGGTATCGCTGTCGTGCCAGGTGTGGG
ATCGAGGGCGGCATTCAGATACTA


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000418A_C02 KCC000418A_c02
         (864 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

gb|AAF03178.1|AF110138_10 ATP synthase F0 subunit 9 [Nephroselmi...   108  9e-23
ref|NP_042270.1| H(+)-transporting ATPase, subunit 9 [Prototheca...   108  1e-22
gb|AAP92171.1| ATP synthase F0 subunit 9 [Chara vulgaris]             102  8e-21
ref|NP_057990.1| ATPase subunit 9 [Scenedesmus obliquus] gi|7711...   100  5e-20
ref|NP_054462.1| putative [Marchantia polymorpha] gi|416675|sp|P...    99  1e-19

>gb|AAF03178.1|AF110138_10 ATP synthase F0 subunit 9 [Nephroselmis olivacea]
          Length = 74

 Score =  108 bits (271), Expect = 9e-23
 Identities = 50/72 (69%), Positives = 64/72 (88%)
 Frame = +3

Query: 294 VLAASKMVGAGCATIALAGVGAGLGVMFGSLINGAARNPNIAKQLVGYALLGFALTESIA 473
           +L  +K++GAGCATIALAG GAG+G++FGSLIN  ARNP++ KQL GYA+LGFALTE+IA
Sbjct: 1   MLEGAKLIGAGCATIALAGAGAGIGIVFGSLINSVARNPSLTKQLFGYAILGFALTEAIA 60

Query: 474 LFSLLVVFLILF 509
           LF+L++ FLILF
Sbjct: 61  LFALMMAFLILF 72

>ref|NP_042270.1| H(+)-transporting ATPase, subunit 9 [Prototheca wickerhamii]
           gi|7436183|pir||T11939 H(+)-transporting ATPase, subunit
           9 - Prototheca wickerhamii mitochondrion
           gi|467871|gb|AAD12658.1| H(+)-transporting ATPase,
           subunit 9 [Prototheca wickerhamii]
          Length = 74

 Score =  108 bits (270), Expect = 1e-22
 Identities = 50/72 (69%), Positives = 64/72 (88%)
 Frame = +3

Query: 294 VLAASKMVGAGCATIALAGVGAGLGVMFGSLINGAARNPNIAKQLVGYALLGFALTESIA 473
           +L  +K++GAGCATIALAG GAG+G++FGSLIN  ARNP++ KQL GYA+LGFALTE+IA
Sbjct: 1   MLDGAKLIGAGCATIALAGAGAGIGIVFGSLINSVARNPSLTKQLFGYAILGFALTEAIA 60

Query: 474 LFSLLVVFLILF 509
           LF+L++ FLILF
Sbjct: 61  LFALMMAFLILF 72

>gb|AAP92171.1| ATP synthase F0 subunit 9 [Chara vulgaris]
          Length = 76

 Score =  102 bits (254), Expect = 8e-21
 Identities = 48/74 (64%), Positives = 63/74 (84%)
 Frame = +3

Query: 288 MSVLAASKMVGAGCATIALAGVGAGLGVMFGSLINGAARNPNIAKQLVGYALLGFALTES 467
           M++L  +K++GAGCATIALAG   G+G +F SLI+  ARNP++AKQL GYA+LGFALTE+
Sbjct: 1   MAMLEGAKLIGAGCATIALAGAAVGIGNVFSSLIHSVARNPSLAKQLFGYAILGFALTEA 60

Query: 468 IALFSLLVVFLILF 509
           IALF+L++ FLILF
Sbjct: 61  IALFALMMAFLILF 74

>ref|NP_057990.1| ATPase subunit 9 [Scenedesmus obliquus] gi|7711051|emb|CAB90375.1|
           ATPase subunit 9 [Scenedesmus obliquus]
           gi|8099194|gb|AAF72049.1|AF204057_4 ATP synthase F0
           subunit 9 [Scenedesmus obliquus]
          Length = 73

 Score = 99.8 bits (247), Expect = 5e-20
 Identities = 49/72 (68%), Positives = 61/72 (84%)
 Frame = +3

Query: 294 VLAASKMVGAGCATIALAGVGAGLGVMFGSLINGAARNPNIAKQLVGYALLGFALTESIA 473
           ++ A K++GAG A IALAGVGAG+G++FG+LI  A RNP +AK+L+GYALLGFAL ES+A
Sbjct: 1   MVQARKLIGAGSALIALAGVGAGIGIVFGALIQRARRNPQMAKRLMGYALLGFALCESVA 60

Query: 474 LFSLLVVFLILF 509
           LF LLV FLILF
Sbjct: 61  LFRLLVTFLILF 72

>ref|NP_054462.1| putative [Marchantia polymorpha] gi|416675|sp|P26855|ATP9_MARPO ATP
           synthase protein 9, mitochondrial (Lipid-binding
           protein) gi|282755|pir||S25960 H+-transporting
           two-sector ATPase (EC 3.6.3.14) lipid-binding protein -
           liverwort (Marchantia polymorpha) mitochondrion
           gi|786245|gb|AAC09459.1| putative [Marchantia
           polymorpha]
          Length = 74

 Score = 98.6 bits (244), Expect = 1e-19
 Identities = 47/72 (65%), Positives = 60/72 (83%)
 Frame = +3

Query: 294 VLAASKMVGAGCATIALAGVGAGLGVMFGSLINGAARNPNIAKQLVGYALLGFALTESIA 473
           +L  +K++GAG ATIALAG   G+G +F SLIN  ARNP++AKQL GYA+LGFALTE+IA
Sbjct: 1   MLEGAKLIGAGAATIALAGAAVGIGNVFSSLINSVARNPSLAKQLFGYAILGFALTEAIA 60

Query: 474 LFSLLVVFLILF 509
           LF+L++ FLILF
Sbjct: 61  LFALMMAFLILF 72



EST assemble image


clone accession position
1 MX028a07_r BP087200 1 552
2 CM048a08_r AV389139 75 395
3 CM075a06_r AV391648 78 702
4 MX011g04_r BP086569 82 490
5 LC074c03_r AV624195 83 587
6 MXL024e02_r BP094529 85 391
7 CM013g12_r AV387108 85 657
8 CM049f08_r AV389593 85 467
9 HC082b03_r AV638113 85 585
10 HC082g10_r AV638169 85 504
11 HC044a02_r AV635258 85 556
12 LC089a09_r AV625188 85 587
13 CM036g10_r AV388805 85 376
14 HC053e05_r AV635972 85 417
15 HCL072c05_r AV643584 85 579
16 CM070g01_r AV391250 85 615
17 MX250a06_r BP092121 86 563
18 LC071h04_r AV624021 87 598
19 LC061a10_r AV623250 87 584
20 HC017e10_r AV633167 89 586
21 MX047c09_r BP087932 92 447
22 HCL083c12_r AV644175 92 566
23 CL33h01_r AV394969 93 601
24 MXL085d11_r BP098020 122 498
25 HC097e05_r AV639294 361 886
26 CL27c04_r AV394716 524 957




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research