KCC000417A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000417A_C01 KCC000417A_c01
CTCGCCTAATCCTCACGTCAATTTTCGACACCACCACCAGCAGAAATGGCCCTCCGCGCT
GTCTCCGCCAAGAGCGCTGTGCGCCCCACCGTGGCCCGCGCCTCCGTCAAGCCGGTGGCT
GCCCTGAAGCCCGCCCAGAAGATGGCTCTGGCTGGCGCTGCCTCGGTTGCCCTGCTGGCT
GCCTCCAGCTCCTCGGCTGAGGCTTCCCAGGTGATCGCCACCGTGGCCTCCGCTGCCCAG
GGCTACCCCCTTCGTGCCCCCCTCGTGGGCTCCCTCGGTCTTCGTGCCCCTGACCGGCCT
GGTGCTGCCCGCCATCGCCATGGCCACCCTGTTCGTGTACATTGAGAAGGAGGCCCCCTC
CTCGTAAGCGCCTCGCCATGGTGCTTGCCGCCCCGTTGTGGAGCCGCCTGGCGTGCAGCC
AGCGGCCCTGTGGCGCCGGCGTCTTGGAATGTAGATGTGATGTGTACAGCTAGGGAGGGA
GCTGGCGGCCTCTGGCGGCCGCTCTGAGCGCGAAGGGAGGTGTTGATGAGGGTGAAGCAT
GCGGTGGCGGCGGCTGGAAGGGCCGCGCAGCACGGCTTGTGTGTATTTCCTCCGTCCCTG
GCCCCCGCACACCGGTCACGTTTCGCTGAAGTCCGGCGCGCGCGGGTGCACAGCCCGGCG
TGTCTTTCGGGGGCGCTGTGTTCTGGACGGGTCCCGGCGCCCTCGAGTGGGCATTTTGGA
GCACCTGAAGGCCTCAGGATTAGCGCAGGCGGCAGGGCGTGTGTCGGTGTGGGCGGTGGG
CAGGGCGGCGGTTCCAAGAGAAGAGACAAAGTTTATTGCGGCCGGTTCCGCGGCCAATGT
TTTAGTGTAAACAAGGACCCGTCAAAAAAAAACAAAAAAAAAAAAAAAAAC


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000417A_C01 KCC000417A_c01
         (891 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|NP_178626.1| glycine-rich protein [Arabidopsis thaliana] gi|...    52  3e-08
gb|AAP40445.1| unknown protein [Arabidopsis thaliana]                  49  6e-08
ref|NP_501522.1| putative secreted or extracellular protein prec...    59  1e-07
emb|CAA90992.2| Hypothetical protein T28C6.1 [Caenorhabditis ele...    59  1e-07
dbj|BAC83736.1| hypothetical protein [Oryza sativa (japonica cul...    59  1e-07

>ref|NP_178626.1| glycine-rich protein [Arabidopsis thaliana] gi|25295693|pir||C84470
           hypothetical protein At2g05580 [imported] - Arabidopsis
           thaliana gi|4581166|gb|AAD24649.1| unknown protein
           [Arabidopsis thaliana]
          Length = 302

 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 30/78 (38%), Positives = 37/78 (46%), Gaps = 2/78 (2%)
 Frame = -1

Query: 276 EGAHEGGTKGVALGS--GGHGGDHLGSLSRGAGGSQQGNRGSASQSHLLGGLQGSHRLDG 103
           +G H+GG  G   G   GG GG   G   +G GG Q G++G     H+ GG +G     G
Sbjct: 220 QGGHKGGGGGGGQGGHKGGGGGGQGGGGHKGGGGGQGGHKGGGGGGHVGGGGRGG----G 275

Query: 102 GAGHGGAHSALGGDSAEG 49
           G G GG  S  GG    G
Sbjct: 276 GGGRGGGGSGGGGGGGSG 293

 Score = 50.1 bits (118), Expect(2) = 3e-08
 Identities = 31/76 (40%), Positives = 35/76 (45%)
 Frame = -1

Query: 273 GAHEGGTKGVALGSGGHGGDHLGSLSRGAGGSQQGNRGSASQSHLLGGLQGSHRLDGGAG 94
           G  +GG KG   G GG  G H G    G GG Q G++G        GG QG H+  GG G
Sbjct: 194 GRGQGGMKG---GGGGGQGGHKGG---GGGGGQGGHKGGGG-----GGGQGGHKGGGGGG 242

Query: 93  HGGAHSALGGDSAEGH 46
            GG     GG    GH
Sbjct: 243 QGGGGHKGGGGGQGGH 258

 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 31/84 (36%), Positives = 38/84 (44%), Gaps = 3/84 (3%)
 Frame = -1

Query: 291 RGTKTEGAHEGGTKGVALGSGGH---GGDHLGSLSRGAGGSQQGNRGSASQSHLLGGLQG 121
           +G +  G  +GG KG   G GG    GG   G +  G GG Q G++G        GG QG
Sbjct: 168 QGGQKGGGGQGGQKGGG-GQGGQKGGGGRGQGGMKGGGGGGQGGHKGGGG-----GGGQG 221

Query: 120 SHRLDGGAGHGGAHSALGGDSAEG 49
            H+  GG G  G H   GG    G
Sbjct: 222 GHKGGGGGGGQGGHKGGGGGGQGG 245

 Score = 46.6 bits (109), Expect = 6e-04
 Identities = 28/81 (34%), Positives = 34/81 (41%)
 Frame = -1

Query: 291 RGTKTEGAHEGGTKGVALGSGGHGGDHLGSLSRGAGGSQQGNRGSASQSHLLGGLQGSHR 112
           +G +  G  +GG KG     G  GG   G    G G  Q G +G        GG QG H+
Sbjct: 159 QGGQKGGGGQGGQKGGGGQGGQKGGGGQGGQKGGGGRGQGGMKGGG------GGGQGGHK 212

Query: 111 LDGGAGHGGAHSALGGDSAEG 49
             GG G  G H   GG   +G
Sbjct: 213 GGGGGGGQGGHKGGGGGGGQG 233

 Score = 46.2 bits (108), Expect = 7e-04
 Identities = 29/68 (42%), Positives = 33/68 (47%)
 Frame = -1

Query: 288 GTKTEGAHEGGTKGVALGSGGHGGDHLGSLSRGAGGSQQGNRGSASQSHLLGGLQGSHRL 109
           G +  G H+GG  G     GG GG H+G   RG GG  +G  GS       GG  GS R 
Sbjct: 241 GGQGGGGHKGGGGGQGGHKGGGGGGHVGGGGRGGGGGGRGGGGSGG-----GGGGGSGR- 294

Query: 108 DGGAGHGG 85
            GG G GG
Sbjct: 295 -GGGGGGG 301

 Score = 44.3 bits (103), Expect = 0.003
 Identities = 31/81 (38%), Positives = 34/81 (41%), Gaps = 5/81 (6%)
 Frame = -1

Query: 273 GAHEGGTKGVALGSGGHGGDHLGSLSRG--AGGSQQGNRGSASQSHLLGGL---QGSHRL 109
           G  +GG KG   G GG GG   G    G   GG Q G +G   Q    GG    QG  + 
Sbjct: 145 GGGQGGQKGG--GGGGQGGQKGGGGQGGQKGGGGQGGQKGGGGQGGQKGGGGRGQGGMKG 202

Query: 108 DGGAGHGGAHSALGGDSAEGH 46
            GG G GG     GG    GH
Sbjct: 203 GGGGGQGGHKGGGGGGGQGGH 223

 Score = 43.9 bits (102), Expect = 0.004
 Identities = 28/77 (36%), Positives = 32/77 (41%), Gaps = 2/77 (2%)
 Frame = -1

Query: 273 GAHEGGTKGVALGSGGH--GGDHLGSLSRGAGGSQQGNRGSASQSHLLGGLQGSHRLDGG 100
           G  +GG KG   G GG   GG   G    G GG Q G +G        GG QG  +  GG
Sbjct: 103 GGGQGGQKGGGGGQGGQKGGGGGQGGQKGGGGGGQGGQKGGG------GGGQGGQKGGGG 156

Query: 99  AGHGGAHSALGGDSAEG 49
            G GG     G    +G
Sbjct: 157 GGQGGQKGGGGQGGQKG 173

 Score = 43.9 bits (102), Expect(2) = 4e-05
 Identities = 29/81 (35%), Positives = 33/81 (39%), Gaps = 6/81 (7%)
 Frame = -1

Query: 273 GAHEGGTKGVALGSGGHGGDHLGSLSRGAGGSQQGNRGSASQSHLLGGL------QGSHR 112
           G  +GG KG     GG GG   G    G GG Q G++G        GG       QG H+
Sbjct: 205 GGGQGGHKG-----GGGGGGQGGHKGGGGGGGQGGHKGGGGGGQGGGGHKGGGGGQGGHK 259

Query: 111 LDGGAGHGGAHSALGGDSAEG 49
             GG GH G     GG    G
Sbjct: 260 GGGGGGHVGGGGRGGGGGGRG 280

 Score = 43.5 bits (101), Expect = 0.005
 Identities = 28/70 (40%), Positives = 31/70 (44%)
 Frame = -1

Query: 273 GAHEGGTKGVALGSGGHGGDHLGSLSRGAGGSQQGNRGSASQSHLLGGLQGSHRLDGGAG 94
           G  +GG KG   G GG GG   G    G GG + G  G   Q    GG QG  +  GG G
Sbjct: 92  GGGQGGQKGG--GGGGQGGQKGGG--GGQGGQKGGGGGQGGQKGGGGGGQGGQKGGGGGG 147

Query: 93  HGGAHSALGG 64
            GG     GG
Sbjct: 148 QGGQKGGGGG 157

 Score = 42.4 bits (98), Expect = 0.011
 Identities = 29/87 (33%), Positives = 33/87 (37%), Gaps = 10/87 (11%)
 Frame = -1

Query: 276 EGAHEGGTKGVALGSGGHGGDHLGSLSRGAGGSQQGNRGSASQ----------SHLLGGL 127
           +G  +GG  G   G  G GG   G    G GG Q G +G   Q              GG 
Sbjct: 126 QGGQKGGGGGGQGGQKGGGGGGQGGQKGGGGGGQGGQKGGGGQGGQKGGGGQGGQKGGGG 185

Query: 126 QGSHRLDGGAGHGGAHSALGGDSAEGH 46
           QG  +  GG G GG     GG    GH
Sbjct: 186 QGGQKGGGGRGQGGMKGG-GGGGQGGH 211

 Score = 41.2 bits (95), Expect = 0.024
 Identities = 27/70 (38%), Positives = 30/70 (42%)
 Frame = -1

Query: 273 GAHEGGTKGVALGSGGHGGDHLGSLSRGAGGSQQGNRGSASQSHLLGGLQGSHRLDGGAG 94
           G  +GG KG   G GG  G   G    G GG + G  G   Q    GG QG  +  GG G
Sbjct: 81  GRGQGGQKG---GGGGGQGGQKGGGGGGQGGQKGGGGGQGGQKG-GGGGQGGQKGGGGGG 136

Query: 93  HGGAHSALGG 64
            GG     GG
Sbjct: 137 QGGQKGGGGG 146

 Score = 40.8 bits (94), Expect = 0.031
 Identities = 30/86 (34%), Positives = 34/86 (38%), Gaps = 6/86 (6%)
 Frame = -1

Query: 288 GTKTEGAHEGGTKGVALGSGGH---GGDHLGSLSRGAGGSQQGNRGSASQSH---LLGGL 127
           G K  G  +GG KG   G GG    GG   G    G GG Q G +G           GG 
Sbjct: 108 GQKGGGGGQGGQKGGGGGQGGQKGGGGGGQGGQKGGGGGGQGGQKGGGGGGQGGQKGGGG 167

Query: 126 QGSHRLDGGAGHGGAHSALGGDSAEG 49
           QG  +  GG G GG     G    +G
Sbjct: 168 QGGQK--GGGGQGGQKGGGGQGGQKG 191

 Score = 38.9 bits (89), Expect = 0.12
 Identities = 18/33 (54%), Positives = 21/33 (63%), Gaps = 1/33 (3%)
 Frame = -3

Query: 331 QGGH-GDGGQHQAGQGHEDRGSPRGGHEGGSPG 236
           QGGH G GG  Q G GH+  G  +GGH+GG  G
Sbjct: 232 QGGHKGGGGGGQGGGGHKGGGGGQGGHKGGGGG 264

 Score = 30.8 bits (68), Expect(2) = 3e-08
 Identities = 17/41 (41%), Positives = 23/41 (55%), Gaps = 1/41 (2%)
 Frame = -3

Query: 364 RGGGLLLNVHEQGGHGDGGQH-QAGQGHEDRGSPRGGHEGG 245
           +GGG      ++GG G GGQ    GQG +  G  +GG +GG
Sbjct: 152 KGGGGGGQGGQKGGGGQGGQKGGGGQGGQKGGGGQGGQKGG 192

 Score = 26.2 bits (56), Expect(2) = 4e-05
 Identities = 16/43 (37%), Positives = 22/43 (50%), Gaps = 3/43 (6%)
 Frame = -3

Query: 364 RGGGLLLNVHEQGGHGDGGQHQ---AGQGHEDRGSPRGGHEGG 245
           +GGG      ++GG G G   Q    GQG +  G  +GG +GG
Sbjct: 141 KGGGGGGQGGQKGGGGGGQGGQKGGGGQGGQKGGGGQGGQKGG 183

>gb|AAP40445.1| unknown protein [Arabidopsis thaliana]
          Length = 273

 Score = 48.9 bits (115), Expect(2) = 6e-08
 Identities = 32/76 (42%), Positives = 36/76 (47%), Gaps = 1/76 (1%)
 Frame = -1

Query: 273 GAHEGGTKGVALGSGGHGGDHLGSLSRGAGGSQQGNRGSASQSHLLGGLQGSHRLDGGAG 94
           G  +GG KG   G GG  G H G    G GG Q G++G        GG QG H+  GG G
Sbjct: 194 GRGQGGMKG---GGGGGQGGHKGG---GGGGGQGGHKGGGG-----GGGQGGHKGGGGGG 242

Query: 93  H-GGAHSALGGDSAEG 49
             GG H   GG S  G
Sbjct: 243 QGGGGHKGGGGGSGGG 258

 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 31/84 (36%), Positives = 38/84 (44%), Gaps = 3/84 (3%)
 Frame = -1

Query: 291 RGTKTEGAHEGGTKGVALGSGGH---GGDHLGSLSRGAGGSQQGNRGSASQSHLLGGLQG 121
           +G +  G  +GG KG   G GG    GG   G +  G GG Q G++G        GG QG
Sbjct: 168 QGGQKGGGGQGGQKGGG-GQGGQKGGGGRGQGGMKGGGGGGQGGHKGGGG-----GGGQG 221

Query: 120 SHRLDGGAGHGGAHSALGGDSAEG 49
            H+  GG G  G H   GG    G
Sbjct: 222 GHKGGGGGGGQGGHKGGGGGGQGG 245

 Score = 46.6 bits (109), Expect = 6e-04
 Identities = 28/81 (34%), Positives = 34/81 (41%)
 Frame = -1

Query: 291 RGTKTEGAHEGGTKGVALGSGGHGGDHLGSLSRGAGGSQQGNRGSASQSHLLGGLQGSHR 112
           +G +  G  +GG KG     G  GG   G    G G  Q G +G        GG QG H+
Sbjct: 159 QGGQKGGGGQGGQKGGGGQGGQKGGGGQGGQKGGGGRGQGGMKGGG------GGGQGGHK 212

Query: 111 LDGGAGHGGAHSALGGDSAEG 49
             GG G  G H   GG   +G
Sbjct: 213 GGGGGGGQGGHKGGGGGGGQG 233

 Score = 44.3 bits (103), Expect = 0.003
 Identities = 31/81 (38%), Positives = 34/81 (41%), Gaps = 5/81 (6%)
 Frame = -1

Query: 273 GAHEGGTKGVALGSGGHGGDHLGSLSRG--AGGSQQGNRGSASQSHLLGGL---QGSHRL 109
           G  +GG KG   G GG GG   G    G   GG Q G +G   Q    GG    QG  + 
Sbjct: 145 GGGQGGQKGG--GGGGQGGQKGGGGQGGQKGGGGQGGQKGGGGQGGQKGGGGRGQGGMKG 202

Query: 108 DGGAGHGGAHSALGGDSAEGH 46
            GG G GG     GG    GH
Sbjct: 203 GGGGGQGGHKGGGGGGGQGGH 223

 Score = 43.9 bits (102), Expect = 0.004
 Identities = 28/77 (36%), Positives = 32/77 (41%), Gaps = 2/77 (2%)
 Frame = -1

Query: 273 GAHEGGTKGVALGSGGH--GGDHLGSLSRGAGGSQQGNRGSASQSHLLGGLQGSHRLDGG 100
           G  +GG KG   G GG   GG   G    G GG Q G +G        GG QG  +  GG
Sbjct: 103 GGGQGGQKGGGGGQGGQKGGGGGQGGQKGGGGGGQGGQKGGG------GGGQGGQKGGGG 156

Query: 99  AGHGGAHSALGGDSAEG 49
            G GG     G    +G
Sbjct: 157 GGQGGQKGGGGQGGQKG 173

 Score = 43.5 bits (101), Expect = 0.005
 Identities = 28/70 (40%), Positives = 31/70 (44%)
 Frame = -1

Query: 273 GAHEGGTKGVALGSGGHGGDHLGSLSRGAGGSQQGNRGSASQSHLLGGLQGSHRLDGGAG 94
           G  +GG KG   G GG GG   G    G GG + G  G   Q    GG QG  +  GG G
Sbjct: 92  GGGQGGQKGG--GGGGQGGQKGGG--GGQGGQKGGGGGQGGQKGGGGGGQGGQKGGGGGG 147

Query: 93  HGGAHSALGG 64
            GG     GG
Sbjct: 148 QGGQKGGGGG 157

 Score = 42.4 bits (98), Expect = 0.011
 Identities = 29/87 (33%), Positives = 33/87 (37%), Gaps = 10/87 (11%)
 Frame = -1

Query: 276 EGAHEGGTKGVALGSGGHGGDHLGSLSRGAGGSQQGNRGSASQ----------SHLLGGL 127
           +G  +GG  G   G  G GG   G    G GG Q G +G   Q              GG 
Sbjct: 126 QGGQKGGGGGGQGGQKGGGGGGQGGQKGGGGGGQGGQKGGGGQGGQKGGGGQGGQKGGGG 185

Query: 126 QGSHRLDGGAGHGGAHSALGGDSAEGH 46
           QG  +  GG G GG     GG    GH
Sbjct: 186 QGGQKGGGGRGQGGMKGG-GGGGQGGH 211

 Score = 42.0 bits (97), Expect = 0.014
 Identities = 26/71 (36%), Positives = 32/71 (44%)
 Frame = -1

Query: 276 EGAHEGGTKGVALGSGGHGGDHLGSLSRGAGGSQQGNRGSASQSHLLGGLQGSHRLDGGA 97
           +G H+GG      G GG  G H G    G GG Q G++G        GG +G     GG 
Sbjct: 208 QGGHKGG------GGGGGQGGHKGG---GGGGGQGGHKGGGGGGQGGGGHKGGGGGSGGG 258

Query: 96  GHGGAHSALGG 64
           G GG+    GG
Sbjct: 259 GGGGSGRGGGG 269

 Score = 41.2 bits (95), Expect = 0.024
 Identities = 27/70 (38%), Positives = 30/70 (42%)
 Frame = -1

Query: 273 GAHEGGTKGVALGSGGHGGDHLGSLSRGAGGSQQGNRGSASQSHLLGGLQGSHRLDGGAG 94
           G  +GG KG   G GG  G   G    G GG + G  G   Q    GG QG  +  GG G
Sbjct: 81  GRGQGGQKG---GGGGGQGGQKGGGGGGQGGQKGGGGGQGGQKG-GGGGQGGQKGGGGGG 136

Query: 93  HGGAHSALGG 64
            GG     GG
Sbjct: 137 QGGQKGGGGG 146

 Score = 40.8 bits (94), Expect = 0.031
 Identities = 30/86 (34%), Positives = 34/86 (38%), Gaps = 6/86 (6%)
 Frame = -1

Query: 288 GTKTEGAHEGGTKGVALGSGGH---GGDHLGSLSRGAGGSQQGNRGSASQSH---LLGGL 127
           G K  G  +GG KG   G GG    GG   G    G GG Q G +G           GG 
Sbjct: 108 GQKGGGGGQGGQKGGGGGQGGQKGGGGGGQGGQKGGGGGGQGGQKGGGGGGQGGQKGGGG 167

Query: 126 QGSHRLDGGAGHGGAHSALGGDSAEG 49
           QG  +  GG G GG     G    +G
Sbjct: 168 QGGQK--GGGGQGGQKGGGGQGGQKG 191

 Score = 33.9 bits (76), Expect = 3.8
 Identities = 17/34 (50%), Positives = 19/34 (55%), Gaps = 1/34 (2%)
 Frame = -3

Query: 331 QGGH-GDGGQHQAGQGHEDRGSPRGGHEGGSPGQ 233
           QGGH G GG  Q G GH+  G   GG  GG  G+
Sbjct: 232 QGGHKGGGGGGQGGGGHKGGGGGSGGGGGGGSGR 265

 Score = 30.8 bits (68), Expect(2) = 6e-08
 Identities = 17/41 (41%), Positives = 23/41 (55%), Gaps = 1/41 (2%)
 Frame = -3

Query: 364 RGGGLLLNVHEQGGHGDGGQHQAG-QGHEDRGSPRGGHEGG 245
           +GGG      ++GG G GGQ   G QG +  G  +GG +GG
Sbjct: 152 KGGGGGGQGGQKGGGGQGGQKGGGGQGGQKGGGGQGGQKGG 192

>ref|NP_501522.1| putative secreted or extracellular protein precursor (4J583)
           [Caenorhabditis elegans] gi|7508657|pir||T25404
           hypothetical protein T28C6.1 - Caenorhabditis elegans
          Length = 274

 Score = 58.5 bits (140), Expect = 1e-07
 Identities = 44/128 (34%), Positives = 56/128 (43%), Gaps = 4/128 (3%)
 Frame = -1

Query: 420 GCTPGGSTTGRQAPWRGAYEEGASFSMYTNRVAMAMAGSTRPVRGTKTEGAHEG----GT 253
           G +  GS  G    W G+     + +  T        G +   RG  + G   G    G 
Sbjct: 36  GGSDAGSGIGSSGGWGGSDASAGASAGGTGGGRGGGRGGSGGGRGGGSGGGRGGSGGAGA 95

Query: 252 KGVALGSGGHGGDHLGSLSRGAGGSQQGNRGSASQSHLLGGLQGSHRLDGGAGHGGAHSA 73
            G   GSGG GG   GS + G GGSQ G++G +S     GG  GS R D G+G GG    
Sbjct: 96  GGSGSGSGGWGGQDGGSSAGGWGGSQGGSQGGSS-----GGWGGSSRSDSGSGQGGWGGQ 150

Query: 72  LGGDSAEG 49
            GG+S  G
Sbjct: 151 QGGNSNAG 158

 Score = 42.4 bits (98), Expect = 0.011
 Identities = 28/77 (36%), Positives = 37/77 (47%), Gaps = 5/77 (6%)
 Frame = -1

Query: 273 GAHEGGTKGVALGSGGHGGDHLGSLSRGAGGSQQGNRGSA-----SQSHLLGGLQGSHRL 109
           G  +GG +G   G GG+ G   G    G GGSQ G++G +     +Q    GG +G  + 
Sbjct: 199 GGGQGGNQGGGGGRGGNQGGEQGGWG-GQGGSQGGSQGGSQGGWGNQGGQQGGGRGGQQG 257

Query: 108 DGGAGHGGAHSALGGDS 58
            GG G GG     GG S
Sbjct: 258 PGGWGGGGRGGGWGGKS 274

 Score = 40.8 bits (94), Expect = 0.031
 Identities = 42/144 (29%), Positives = 50/144 (34%), Gaps = 13/144 (9%)
 Frame = -1

Query: 426 AAGCTPGGSTTGRQAPWRGAYEEGASFSMYTNRVAMAMAGSTRPVRGTKTEGAHEGGTKG 247
           +AG + GG+  GR    RG    G        R     AG+     G+   G  +GG+  
Sbjct: 56  SAGASAGGTGGGRGGG-RGGSGGGRGGGSGGGRGGSGGAGAGGSGSGSGGWGGQDGGSSA 114

Query: 246 VALG----------SGGHGGDHL---GSLSRGAGGSQQGNRGSASQSHLLGGLQGSHRLD 106
              G          SGG GG      GS   G GG Q GN  +       GG QG     
Sbjct: 115 GGWGGSQGGSQGGSSGGWGGSSRSDSGSGQGGWGGQQGGNSNAGG----WGGSQGGQNGG 170

Query: 105 GGAGHGGAHSALGGDSAEGHFCWW 34
           GG G  G     GG    G    W
Sbjct: 171 GGRGGSGGQGGWGGSQDGGSQGGW 194

 Score = 40.4 bits (93), Expect = 0.040
 Identities = 39/128 (30%), Positives = 47/128 (36%), Gaps = 4/128 (3%)
 Frame = -1

Query: 420 GCTPGGSTTGRQAPWRGAYEEGASFSMYTNRVAMAMAGSTRPVRGTKTEGAHEGGTKGVA 241
           G + GGS  G    W G+     S S            S     G    G + GG +G +
Sbjct: 118 GGSQGGSQGGSSGGWGGS-SRSDSGSGQGGWGGQQGGNSNAGGWGGSQGGQNGGGGRGGS 176

Query: 240 LGSGGHGGDHLGSLSRG----AGGSQQGNRGSASQSHLLGGLQGSHRLDGGAGHGGAHSA 73
            G GG GG   G    G     GG Q GN+G        GG QG  +  G  G GG+   
Sbjct: 177 GGQGGWGGSQDGGSQGGWGGQNGGGQGGNQGGGGGR---GGNQGGEQ-GGWGGQGGSQGG 232

Query: 72  LGGDSAEG 49
             G S  G
Sbjct: 233 SQGGSQGG 240

 Score = 36.6 bits (83), Expect = 0.58
 Identities = 27/84 (32%), Positives = 38/84 (45%), Gaps = 5/84 (5%)
 Frame = -1

Query: 273 GAHEGGTKGVALGSGGHGGDHLGSLSRGAGGSQQGNRGS-----ASQSHLLGGLQGSHRL 109
           G+ +GG++G   G GG  G   G  ++G GG + GN+G        Q    GG QG  + 
Sbjct: 184 GSQDGGSQG---GWGGQNGGGQGG-NQGGGGGRGGNQGGEQGGWGGQGGSQGGSQGGSQ- 238

Query: 108 DGGAGHGGAHSALGGDSAEGHFCW 37
            GG G+ G     G    +G   W
Sbjct: 239 -GGWGNQGGQQGGGRGGQQGPGGW 261

 Score = 34.3 bits (77), Expect = 2.9
 Identities = 27/85 (31%), Positives = 34/85 (39%), Gaps = 3/85 (3%)
 Frame = -1

Query: 294 VRGTKTEGAHEGGTKGVALGS-GGHGGDHL--GSLSRGAGGSQQGNRGSASQSHLLGGLQ 124
           + G   +G   G   G  +GS GG GG     G+ + G GG + G RG +      GG  
Sbjct: 26  ISGDSGDGLFGGSDAGSGIGSSGGWGGSDASAGASAGGTGGGRGGGRGGSG-----GGR- 79

Query: 123 GSHRLDGGAGHGGAHSALGGDSAEG 49
                  G G GG     GG  A G
Sbjct: 80  -------GGGSGGGRGGSGGAGAGG 97

 Score = 32.7 bits (73), Expect = 8.4
 Identities = 35/121 (28%), Positives = 45/121 (36%), Gaps = 4/121 (3%)
 Frame = -3

Query: 427 GRWLHARRLHNGAASTMARRLRGG-GLLLNVHEQGGHGDGGQHQAGQGHEDRGSPRGGHE 251
           G W  ++   NG         +GG G   +   QGG G  GQ+  GQG    G   GG  
Sbjct: 158 GGWGGSQGGQNGGGGRGGSGGQGGWGGSQDGGSQGGWG--GQNGGGQGGNQGG---GGGR 212

Query: 250 GGSPGQRRPRWRSPGKPQPRSWRQPAGQPRQRQPEPSSGRASGQPP---A*RRRGPRWGA 80
           GG+ G  +  W   G  Q  S     G    +  +   GR   Q P       RG  WG 
Sbjct: 213 GGNQGGEQGGWGGQGGSQGGSQGGSQGGWGNQGGQQGGGRGGQQGPGGWGGGGRGGGWGG 272

Query: 79  Q 77
           +
Sbjct: 273 K 273

>emb|CAA90992.2| Hypothetical protein T28C6.1 [Caenorhabditis elegans]
          Length = 281

 Score = 58.5 bits (140), Expect = 1e-07
 Identities = 44/128 (34%), Positives = 56/128 (43%), Gaps = 4/128 (3%)
 Frame = -1

Query: 420 GCTPGGSTTGRQAPWRGAYEEGASFSMYTNRVAMAMAGSTRPVRGTKTEGAHEG----GT 253
           G +  GS  G    W G+     + +  T        G +   RG  + G   G    G 
Sbjct: 24  GGSDAGSGIGSSGGWGGSDASAGASAGGTGGGRGGGRGGSGGGRGGGSGGGRGGSGGAGA 83

Query: 252 KGVALGSGGHGGDHLGSLSRGAGGSQQGNRGSASQSHLLGGLQGSHRLDGGAGHGGAHSA 73
            G   GSGG GG   GS + G GGSQ G++G +S     GG  GS R D G+G GG    
Sbjct: 84  GGSGSGSGGWGGQDGGSSAGGWGGSQGGSQGGSS-----GGWGGSSRSDSGSGQGGWGGQ 138

Query: 72  LGGDSAEG 49
            GG+S  G
Sbjct: 139 QGGNSNAG 146

 Score = 42.4 bits (98), Expect = 0.011
 Identities = 32/95 (33%), Positives = 41/95 (42%), Gaps = 5/95 (5%)
 Frame = -1

Query: 273 GAHEGGTKGVALGSGGHGGDHLGSLSRGAGGSQQGNRGSA-----SQSHLLGGLQGSHRL 109
           G  +GG +G   G GG+ G   G    G GGSQ G++G +     +Q    GG +G  + 
Sbjct: 187 GGGQGGNQGGGGGRGGNQGGEQGGWG-GQGGSQGGSQGGSQGGWGNQGGQQGGGRGGQQG 245

Query: 108 DGGAGHGGAHSALGGDSAEGHFCWWWCRKLT*GLG 4
            GG G GG     GG        W W R    G G
Sbjct: 246 PGGWGGGGRGGGWGGWGRGSR--WGWGRPSWGGWG 278

 Score = 40.8 bits (94), Expect = 0.031
 Identities = 42/144 (29%), Positives = 50/144 (34%), Gaps = 13/144 (9%)
 Frame = -1

Query: 426 AAGCTPGGSTTGRQAPWRGAYEEGASFSMYTNRVAMAMAGSTRPVRGTKTEGAHEGGTKG 247
           +AG + GG+  GR    RG    G        R     AG+     G+   G  +GG+  
Sbjct: 44  SAGASAGGTGGGRGGG-RGGSGGGRGGGSGGGRGGSGGAGAGGSGSGSGGWGGQDGGSSA 102

Query: 246 VALG----------SGGHGGDHL---GSLSRGAGGSQQGNRGSASQSHLLGGLQGSHRLD 106
              G          SGG GG      GS   G GG Q GN  +       GG QG     
Sbjct: 103 GGWGGSQGGSQGGSSGGWGGSSRSDSGSGQGGWGGQQGGNSNAGG----WGGSQGGQNGG 158

Query: 105 GGAGHGGAHSALGGDSAEGHFCWW 34
           GG G  G     GG    G    W
Sbjct: 159 GGRGGSGGQGGWGGSQDGGSQGGW 182

 Score = 40.4 bits (93), Expect = 0.040
 Identities = 39/128 (30%), Positives = 47/128 (36%), Gaps = 4/128 (3%)
 Frame = -1

Query: 420 GCTPGGSTTGRQAPWRGAYEEGASFSMYTNRVAMAMAGSTRPVRGTKTEGAHEGGTKGVA 241
           G + GGS  G    W G+     S S            S     G    G + GG +G +
Sbjct: 106 GGSQGGSQGGSSGGWGGS-SRSDSGSGQGGWGGQQGGNSNAGGWGGSQGGQNGGGGRGGS 164

Query: 240 LGSGGHGGDHLGSLSRG----AGGSQQGNRGSASQSHLLGGLQGSHRLDGGAGHGGAHSA 73
            G GG GG   G    G     GG Q GN+G        GG QG  +  G  G GG+   
Sbjct: 165 GGQGGWGGSQDGGSQGGWGGQNGGGQGGNQGGGGGR---GGNQGGEQ-GGWGGQGGSQGG 220

Query: 72  LGGDSAEG 49
             G S  G
Sbjct: 221 SQGGSQGG 228

 Score = 36.2 bits (82), Expect = 0.76
 Identities = 30/92 (32%), Positives = 35/92 (37%), Gaps = 1/92 (1%)
 Frame = -1

Query: 273 GAHEGGTKGVALGS-GGHGGDHLGSLSRGAGGSQQGNRGSASQSHLLGGLQGSHRLDGGA 97
           GA  GGT G   G  GG GG   G    G GG   G  G+       GG  G    DGG+
Sbjct: 46  GASAGGTGGGRGGGRGGSGGGRGGGSGGGRGG--SGGAGAGGSGSGSGGWGGQ---DGGS 100

Query: 96  GHGGAHSALGGDSAEGHFCWWWCRKLT*GLGE 1
             GG   + GG        W    +   G G+
Sbjct: 101 SAGGWGGSQGGSQGGSSGGWGGSSRSDSGSGQ 132

 Score = 36.2 bits (82), Expect = 0.76
 Identities = 36/123 (29%), Positives = 45/123 (36%), Gaps = 1/123 (0%)
 Frame = -3

Query: 427 GRWLHARRLHNGAASTMARRLRGG-GLLLNVHEQGGHGDGGQHQAGQGHEDRGSPRGGHE 251
           G W  ++   NG         +GG G   +   QGG G  GQ+  GQG    G   GG  
Sbjct: 146 GGWGGSQGGQNGGGGRGGSGGQGGWGGSQDGGSQGGWG--GQNGGGQGGNQGG---GGGR 200

Query: 250 GGSPGQRRPRWRSPGKPQPRSWRQPAGQPRQRQPEPSSGRASGQPPA*RRRGPRWGAQRS 71
           GG+ G  +  W   G  Q  S     G    +  +   GR   Q P     G R G    
Sbjct: 201 GGNQGGEQGGWGGQGGSQGGSQGGSQGGWGNQGGQQGGGRGGQQGPGGWGGGGRGGGWGG 260

Query: 70  WRR 62
           W R
Sbjct: 261 WGR 263

>dbj|BAC83736.1| hypothetical protein [Oryza sativa (japonica cultivar-group)]
          Length = 230

 Score = 58.5 bits (140), Expect = 1e-07
 Identities = 66/203 (32%), Positives = 83/203 (40%), Gaps = 3/203 (1%)
 Frame = -3

Query: 655 GCAPARAGLQRNVTGVRGPGTEEIHTSRAARPFQPPPPHASPSSTPPFALRAAARGRQLP 476
           G  P   G + ++T   GPG   +  + A  P + P P A  +         +AR R   
Sbjct: 27  GLGPREWGPRGSLTDHGGPGAPGLTPAGAVGPTRQPHPRARAADGRAPRGSHSARPRAAK 86

Query: 475 P*LYTSHLHSKTPAPQGRWLHARRLHNGAASTMARRLRGGGLLLNVH--EQGGHGDGGQH 302
           P          TPAP  RW  +     GAA    R  R GG    VH   +G  GDGG  
Sbjct: 87  P---ARSAGGGTPAP--RW--SPPATTGAAERRPREEREGGKEATVHGSPRGDGGDGGGG 139

Query: 301 QAGQGHEDRGSPRGGHEGGSPGQRRPRWRSPGKPQPRSWRQPAGQPRQRQPEPSSGRAS- 125
           ++G G   RGS R G      G RRP+ R              G+ R+   E   G A  
Sbjct: 140 RSG-GRRWRGSGRRGRRRS--GGRRPKRRG-------------GRGRRGCGEAEGGGAEV 183

Query: 124 GQPPA*RRRGPRWGAQRSWRRQR 56
           G  P  RRR  R GA+R WRR+R
Sbjct: 184 GGGPGRRRR--RTGARRRWRRER 204



EST assemble image


clone accession position
1 MXL054d04_r BP096193 1 523
2 HC042f10_r AV635161 -8 525
3 CM070h03_r AV391259 -8 663
4 MXL051h05_r BP096060 -8 514
5 LC077f09_r AV624431 -8 164
6 CM060b07_r AV390775 -8 625
7 LC001f07_r AV618940 -8 555
8 MXL096d09_r BP098622 -8 479
9 HC091a11_r AV638808 -6 440
10 LC039a06_r AV621647 0 349
11 HCL020d03_r AV640673 -5 187
12 MX220c09_r BP090195 -4 355
13 LCL097b06_r AV631623 -4 373
14 MXL056a04_r BP096288 -3 422
15 MXL024e05_r BP094531 -3 399
16 MXL041c01_r BP095397 -3 467
17 LC037c07_r AV621526 -3 554
18 LC039a06_r AV621647 0 349
19 LC002a07_r AV618971 0 483
20 MXL054d04_r BP096193 1 523
21 MX014f03_r BP086697 2 458
22 MX064e07_r BP088594 3 390
23 CM034h03_r AV388624 3 268
24 HC022d05_r AV633568 3 524
25 MX035h06_r BP087505 7 475
26 HC001c04_r BP087505 50 525
27 MXL075a01_r BP097394 223 746
28 MX035c06_r BP087471 388 492
29 CL27b10_r AV394712 397 880
30 CL62c08_r AV396407 401 931
31 CL63e10_r AV396509 401 903
32 LC033f06_r AV621268 479 960




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research