KCC000415A_c02
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000415A_C02 KCC000415A_c02
AGCACGTGCTCGCAAGCCTGGCTCTTCCTCTTTCACCTACCGTCCATAGGACTCTTCTCA
CACCACAGGTGTGCAGCTGGGAGTCGACGTCGACCTCGAGTCGACGCGTAAAAGAGAGTG
TCCCAAACCCCCACTTGGTGGCTGTCTCTTCCTCAGGCCAGCAAAGATGCTTATCCCCAA
GAAGAACCGCAGGGAGGTGTACAAGTACCTCTTCAAGGAGGGTGTCCTTCAGTGCGGAGA
AGGACTTCAACCTCAAGGAGCACCCGGAGATCCCCGGCGTGCCCAACCTGCAGGTCATTA
AGCTCATGCAGAGCCTTCAAGTCCCAGGAGCTGGTGACTGAGCGCTTCTCCTGGCGCCAC
TACTACTGGTTCCTGACCAACAAGGTGCATTGACTACCTGCGCGAGTACCTGAACCTGCC
CAGCGAGATCGTGCCCGCCACCCTGAAGAAGTCCAACCGCCCCCTGGAGCGTGGCCCGCC
CATGCGCGGCGGCGACCGCGGCGACCGCCCGCCCCGCCGTGAGGGTGGCTTCGGTGGCCC
CCGCGAGGGTGGCCGCGAGGGCTACCGCGGTGCTCCCCGCG


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000415A_C02 KCC000415A_c02
         (581 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

sp|Q9LTF2|R103_ARATH 40S ribosomal protein S10-3 gi|8953720|dbj|...    67  4e-20
ref|NP_200077.1| 40S ribosomal protein S10 (RPS10C) [Arabidopsis...    67  4e-20
ref|NP_198967.1| expressed protein [Arabidopsis thaliana] gi|201...    76  3e-13
emb|CAD41005.1| OSJNBa0042L16.19 [Oryza sativa (japonica cultiva...    75  7e-13
ref|NP_194304.1| 40S ribosomal protein S10 (RPS10A) [Arabidopsis...    74  1e-12

>sp|Q9LTF2|R103_ARATH 40S ribosomal protein S10-3 gi|8953720|dbj|BAA98083.1| contains
           similarity to 40S ribosomal protein S10~gene_id:F6N7.14
           [Arabidopsis thaliana]
          Length = 181

 Score = 67.4 bits (163), Expect(3) = 4e-20
 Identities = 40/67 (59%), Positives = 46/67 (67%), Gaps = 3/67 (4%)
 Frame = +2

Query: 389 IDYLREYLNLPSEIVPATLKKSNRPLER---GPPMRGGDRGDRPPRREGGFGGPREGGRE 559
           I++LR YLNLPS++VPATLKKS +P  R   GPP   GDR  R PR EGG   PR G R+
Sbjct: 73  IEFLRTYLNLPSDVVPATLKKSAKPGGRPFGGPP---GDRS-RGPRHEGG-DRPRFGDRD 127

Query: 560 GYRGAPR 580
           GYR  PR
Sbjct: 128 GYRAGPR 134

 Score = 45.4 bits (106), Expect = 6e-04
 Identities = 27/77 (35%), Positives = 39/77 (50%), Gaps = 4/77 (5%)
 Frame = +1

Query: 283 PTCRSLSSCRAFKSQELVTERFSWRHYYWFLTNK-VH*LPARVPEPAQRDRARHPEEVQP 459
           P  + +   ++FKS+E V E F+W HYYWFLTN+ +  L   +  P+    A   +  +P
Sbjct: 38  PNLQVIKLMQSFKSKEYVRETFAWMHYYWFLTNEGIEFLRTYLNLPSDVVPATLKKSAKP 97

Query: 460 ---PPGAWPAHARRRPR 501
              P G  P    R PR
Sbjct: 98  GGRPFGGPPGDRSRGPR 114

 Score = 40.4 bits (93), Expect(3) = 4e-20
 Identities = 21/29 (72%), Positives = 24/29 (82%)
 Frame = +3

Query: 234 AEKDFNLKEHPEIPGVPNLQVIKLMQSLQ 320
           A+KDFNL +HP I  VPNLQVIKLMQS +
Sbjct: 23  AKKDFNLAKHPLID-VPNLQVIKLMQSFK 50

 Score = 32.0 bits (71), Expect(3) = 4e-20
 Identities = 13/20 (65%), Positives = 17/20 (85%)
 Frame = +2

Query: 167 MLIPKKNRREVYKYLFKEGV 226
           M+I + NR+E+ KYLFKEGV
Sbjct: 1   MIISEANRKEICKYLFKEGV 20

>ref|NP_200077.1| 40S ribosomal protein S10 (RPS10C) [Arabidopsis thaliana]
           gi|17528966|gb|AAL38693.1| unknown protein [Arabidopsis
           thaliana] gi|21617950|gb|AAM67000.1| putative ribosomal
           protein S10 [Arabidopsis thaliana]
           gi|21689687|gb|AAM67465.1| unknown protein [Arabidopsis
           thaliana]
          Length = 179

 Score = 67.4 bits (163), Expect(3) = 4e-20
 Identities = 40/67 (59%), Positives = 46/67 (67%), Gaps = 3/67 (4%)
 Frame = +2

Query: 389 IDYLREYLNLPSEIVPATLKKSNRPLER---GPPMRGGDRGDRPPRREGGFGGPREGGRE 559
           I++LR YLNLPS++VPATLKKS +P  R   GPP   GDR  R PR EGG   PR G R+
Sbjct: 73  IEFLRTYLNLPSDVVPATLKKSAKPGGRPFGGPP---GDRS-RGPRHEGG-DRPRFGDRD 127

Query: 560 GYRGAPR 580
           GYR  PR
Sbjct: 128 GYRAGPR 134

 Score = 45.4 bits (106), Expect = 6e-04
 Identities = 27/77 (35%), Positives = 39/77 (50%), Gaps = 4/77 (5%)
 Frame = +1

Query: 283 PTCRSLSSCRAFKSQELVTERFSWRHYYWFLTNK-VH*LPARVPEPAQRDRARHPEEVQP 459
           P  + +   ++FKS+E V E F+W HYYWFLTN+ +  L   +  P+    A   +  +P
Sbjct: 38  PNLQVIKLMQSFKSKEYVRETFAWMHYYWFLTNEGIEFLRTYLNLPSDVVPATLKKSAKP 97

Query: 460 ---PPGAWPAHARRRPR 501
              P G  P    R PR
Sbjct: 98  GGRPFGGPPGDRSRGPR 114

 Score = 40.4 bits (93), Expect(3) = 4e-20
 Identities = 21/29 (72%), Positives = 24/29 (82%)
 Frame = +3

Query: 234 AEKDFNLKEHPEIPGVPNLQVIKLMQSLQ 320
           A+KDFNL +HP I  VPNLQVIKLMQS +
Sbjct: 23  AKKDFNLAKHPLID-VPNLQVIKLMQSFK 50

 Score = 32.0 bits (71), Expect(3) = 4e-20
 Identities = 13/20 (65%), Positives = 17/20 (85%)
 Frame = +2

Query: 167 MLIPKKNRREVYKYLFKEGV 226
           M+I + NR+E+ KYLFKEGV
Sbjct: 1   MIISEANRKEICKYLFKEGV 20

>ref|NP_198967.1| expressed protein [Arabidopsis thaliana]
           gi|20139725|sp|Q9FFS8|R102_ARATH 40S ribosomal protein
           S10-2 gi|10178006|dbj|BAB11458.1| contains similarity to
           40S ribosomal protein S10~gene_id:MBK23.4 [Arabidopsis
           thaliana] gi|14030699|gb|AAK53024.1|AF375440_1
           AT5g41520/MBK23_4 [Arabidopsis thaliana]
           gi|14335122|gb|AAK59840.1| AT5g41520/MBK23_4
           [Arabidopsis thaliana] gi|16974521|gb|AAL31170.1|
           AT5g41520/MBK23_4 [Arabidopsis thaliana]
          Length = 180

 Score = 76.3 bits (186), Expect = 3e-13
 Identities = 61/144 (42%), Positives = 72/144 (49%), Gaps = 6/144 (4%)
 Frame = +2

Query: 167 MLIPKKNRREVYKYLFKEGVLQCGEGLQ-PQ-----GAPGDPRRAQPAGH*AHAEPSSPR 328
           M+I + NRRE+ KYLFKEGVL   +    PQ       P            +        
Sbjct: 1   MIISETNRREISKYLFKEGVLFAKKDFNLPQHPLIESVPNLQVIKLMQSFKSKEYVRETF 60

Query: 329 SW*LSASPGATTTGS*PTRCIDYLREYLNLPSEIVPATLKKSNRPLERGPPMRGGDRGDR 508
           +W +      T  G      ID+LR YLNLPSEIVPATLKK  +PL R P   GGDR   
Sbjct: 61  AW-MHYYWFLTNEG------IDFLRTYLNLPSEIVPATLKKQQKPLGR-PFGGGGDRPRG 112

Query: 509 PPRREGGFGGPREGGREGYRGAPR 580
           PPR   G G  R G R+GYRG P+
Sbjct: 113 PPR---GDGERRFGDRDGYRGGPK 133

 Score = 47.0 bits (110), Expect = 2e-04
 Identities = 34/97 (35%), Positives = 49/97 (50%), Gaps = 1/97 (1%)
 Frame = +1

Query: 283 PTCRSLSSCRAFKSQELVTERFSWRHYYWFLTNK-VH*LPARVPEPAQRDRARHPEEVQP 459
           P  + +   ++FKS+E V E F+W HYYWFLTN+ +  L   +  P++   A   ++ Q 
Sbjct: 39  PNLQVIKLMQSFKSKEYVRETFAWMHYYWFLTNEGIDFLRTYLNLPSEIVPATLKKQ-QK 97

Query: 460 PPGAWPAHARRRPRRPPAPP*GWLRWPPRGWPRGLPR 570
           P G        RPR PP    G  R+  R   RG P+
Sbjct: 98  PLGRPFGGGGDRPRGPPRGD-GERRFGDRDGYRGGPK 133

 Score = 45.4 bits (106), Expect = 6e-04
 Identities = 21/29 (72%), Positives = 24/29 (82%)
 Frame = +3

Query: 234 AEKDFNLKEHPEIPGVPNLQVIKLMQSLQ 320
           A+KDFNL +HP I  VPNLQVIKLMQS +
Sbjct: 23  AKKDFNLPQHPLIESVPNLQVIKLMQSFK 51

>emb|CAD41005.1| OSJNBa0042L16.19 [Oryza sativa (japonica cultivar-group)]
          Length = 183

 Score = 75.1 bits (183), Expect = 7e-13
 Identities = 64/163 (39%), Positives = 74/163 (45%), Gaps = 25/163 (15%)
 Frame = +2

Query: 167 MLIPKKNRREVYKYLFKEGVLQCGEGLQPQGAPGDPRRAQPAGH*AHAEPSSPRSW*LSA 346
           M+IPKKNR E+ KYLF+EGVL          A  D   A+      H +   P    +  
Sbjct: 1   MIIPKKNRNEICKYLFQEGVLY---------AKKDYNLAK------HPQIDVPNLQVIKL 45

Query: 347 SPGATTTGS*PTRCIDYLRE---------------------YLNLPSEIVPATLKKSNRP 463
                +         +Y+RE                     YLNLPSEIVPATLKKS RP
Sbjct: 46  MQSFKSK--------EYVRETFSWQYYYWYLTNDGIEHLRNYLNLPSEIVPATLKKSARP 97

Query: 464 LER----GPPMRGGDRGDRPPRREGGFGGPREGGREGYRGAPR 580
             R    GPP   GDR   PPR EG    PR G R+GYRG PR
Sbjct: 98  PGRPFGSGPP---GDRPRGPPRFEG--DRPRFGDRDGYRGGPR 135

 Score = 49.7 bits (117), Expect = 3e-05
 Identities = 31/96 (32%), Positives = 41/96 (42%)
 Frame = +1

Query: 283 PTCRSLSSCRAFKSQELVTERFSWRHYYWFLTNKVH*LPARVPEPAQRDRARHPEEVQPP 462
           P  + +   ++FKS+E V E FSW++YYW+LTN               D   H       
Sbjct: 38  PNLQVIKLMQSFKSKEYVRETFSWQYYYWYLTN---------------DGIEHLRNYLNL 82

Query: 463 PGAWPAHARRRPRRPPAPP*GWLRWPPRGWPRGLPR 570
           P        ++  RPP  P G    PP   PRG PR
Sbjct: 83  PSEIVPATLKKSARPPGRPFG--SGPPGDRPRGPPR 116

 Score = 41.2 bits (95), Expect = 0.011
 Identities = 20/29 (68%), Positives = 25/29 (85%)
 Frame = +3

Query: 234 AEKDFNLKEHPEIPGVPNLQVIKLMQSLQ 320
           A+KD+NL +HP+I  VPNLQVIKLMQS +
Sbjct: 23  AKKDYNLAKHPQID-VPNLQVIKLMQSFK 50

>ref|NP_194304.1| 40S ribosomal protein S10 (RPS10A) [Arabidopsis thaliana]
           gi|20139845|sp|Q9SW09|R101_ARATH 40S ribosomal protein
           S10-1 gi|7440314|pir||T04228 ribosomal protein S10,
           cytosolic - Arabidopsis thaliana
           gi|4539292|emb|CAB39595.1| putative ribosomal protein
           S10 [Arabidopsis thaliana] gi|7269424|emb|CAB81384.1|
           putative ribosomal protein S10 [Arabidopsis thaliana]
           gi|14334536|gb|AAK59676.1| putative ribosomal protein
           S10 [Arabidopsis thaliana] gi|21281207|gb|AAM44974.1|
           putative ribosomal protein S10 [Arabidopsis thaliana]
          Length = 177

 Score = 73.9 bits (180), Expect = 1e-12
 Identities = 57/142 (40%), Positives = 70/142 (49%), Gaps = 4/142 (2%)
 Frame = +2

Query: 167 MLIPKKNRREVYKYLFKEGVLQCGEGLQPQGAPGDPRRAQPAGH*AHAEPS-SPRSW*LS 343
           M+I + NRRE+ KYLFKEGV    +       P  P    P         S   + +   
Sbjct: 1   MIISENNRREICKYLFKEGVCFAKKDFN---LPKHPLIDVPNLQVIKLMQSFKSKEYVRE 57

Query: 344 ASPGATTTGS*PTRCIDYLREYLNLPSEIVPATLKKSNRPLER---GPPMRGGDRGDRPP 514
                          I++LR YLNLPS++VPATLKKS +P  R   GPP   GDR   PP
Sbjct: 58  TFAWMHYYWFLTNEGIEFLRTYLNLPSDVVPATLKKSAKPGGRPFGGPP---GDRQRGPP 114

Query: 515 RREGGFGGPREGGREGYRGAPR 580
           R +G    PR G R+GYRG PR
Sbjct: 115 RSDGD--RPRFGDRDGYRGGPR 134

 Score = 46.6 bits (109), Expect = 3e-04
 Identities = 31/97 (31%), Positives = 45/97 (45%), Gaps = 1/97 (1%)
 Frame = +1

Query: 283 PTCRSLSSCRAFKSQELVTERFSWRHYYWFLTNK-VH*LPARVPEPAQRDRARHPEEVQP 459
           P  + +   ++FKS+E V E F+W HYYWFLTN+ +  L   +  P+    A   +  +P
Sbjct: 38  PNLQVIKLMQSFKSKEYVRETFAWMHYYWFLTNEGIEFLRTYLNLPSDVVPATLKKSAKP 97

Query: 460 PPGAWPAHARRRPRRPPAPP*GWLRWPPRGWPRGLPR 570
               +      R R PP       R+  R   RG PR
Sbjct: 98  GGRPFGGPPGDRQRGPPRSDGDRPRFGDRDGYRGGPR 134

 Score = 40.4 bits (93), Expect = 0.018
 Identities = 21/29 (72%), Positives = 24/29 (82%)
 Frame = +3

Query: 234 AEKDFNLKEHPEIPGVPNLQVIKLMQSLQ 320
           A+KDFNL +HP I  VPNLQVIKLMQS +
Sbjct: 23  AKKDFNLPKHPLID-VPNLQVIKLMQSFK 50



EST assemble image


clone accession position
1 MX259h02_r BP092838 1 435
2 LC033c10_r AV621243 53 565
3 CM058c12_r AV390408 140 704
4 CM049a03_r AV389596 142 455
5 HC081c02_r AV638051 147 342
6 CM012c01_r AV387159 149 597
7 LC040c04_r AV621731 149 575
8 CM049h03_r AV389605 152 312
9 MX234c02_r BP091130 153 599
10 LC005d07_r AV619227 154 528
11 LC020g06_r AV620337 154 557
12 LC008c06_r AV619430 154 581
13 HCL006c09_r AV639864 154 566
14 HC071e11_r AV637317 155 548
15 MXL002a06_r BP093001 155 604
16 MXL093a08_r BP098418 155 573
17 HC013a04_r AV632819 155 619
18 LCL027f03_r AV627496 155 618
19 HC075a06_r AV637583 157 636
20 HC041c04_r AV635048 157 349
21 MX001f02_r BP086085 157 546
22 HC070b03_r AV637204 157 522
23 CL64b09_r AV396617 157 579
24 CL60e11_r AV396369 157 617
25 MX007f08_r BP086383 157 499
26 HCL043d07_r AV641980 157 633
27 CM003d04_r AV386560 158 629
28 MX203a11_r BP089219 159 558
29 HC013d11_r AV632851 159 582
30 CM088c01_r AV393027 160 609
31 CM099c08_r AV393111 160 439
32 MX234e02_r BP091145 160 480
33 CM035a06_r AV388734 160 676
34 CL35d11_r AV395070 164 450
35 MX254g04_r BP092479 173 497
36 CM074e12_r AV391551 184 740
37 HC090e03_r AV638764 192 573
38 MXL005f05_r BP093249 247 637
39 MXL087b02_r BP098102 247 469
40 LCL047g10_r AV628837 254 726
41 MXL006g11_r BP093324 254 551
42 MXL066a09_r BP096861 258 586
43 CL27b06_r AV394687 432 568
44 MX017h10_r BP086833 437 618




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research