KCC000414A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000414A_C01 KCC000414A_c01
TGCCCGACTCGCTCAAGGCGCGCAAGGACAAGCGCGGCAACCCCTTTGAGTTTCTGGAGC
TGCTCATGTCGCTGACCAAGCGCTGGTAGATGTGTGTGGACGCAAGGATGGAGATGACAC
GGGACGAGAGGGGTCGGATGATGGGGTGGGATGGCACACCGCCGCCCATGCTGTGGTGCG
GGAGTCCTATGACGCAGGCGGGCAAGTCGCGAGGCTTTGAAACTATAAATCCCTGCCGGT
ATTGCAAGTGTACTCGAACTGACTAAAAGTTCTGGCAGCGCCAGTGTTAACGTTCTGTCT
TGACGACGCGAGTGACTTACGACGCTGTCTGCGACCACGGCCTGCGACGCTCCTGGAGGA
GCTGATACTAGGATCTCCTAATTTTGTGGTTTTACCCAAGTTATGGGATTCTGCTGAGCA
TTCGGACCTTGTTTGCGGCGGGACGTGGATGCAATGGCGCGCCCGCTGAACGAACTTGCC
AGTGACCTTCTGGTCAAGTAAGCAGATGATCCAAATGCTCATATCCTGGGACAGTTGGCA
CACAAAG


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000414A_C01 KCC000414A_c01
         (547 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|NP_055932.1| KIAA0150 protein [Homo sapiens] gi|24217449|gb|...    37  0.23
ref|ZP_00053760.1| COG1167: Transcriptional regulators containin...    35  0.86
ref|XP_085151.7| similar to Nuclear protein ZAP3 (ZAP113) [Homo ...    35  0.86
dbj|BAA09771.1| The KIAA0150 gene product is novel. [Homo sapiens]     35  0.86
sp|P49750|ZAP3_HUMAN Nuclear protein ZAP3 (ZAP113) gi|7341427|gb...    35  0.86

>ref|NP_055932.1| KIAA0150 protein [Homo sapiens] gi|24217449|gb|AAH38670.1| KIAA0150
           protein [Homo sapiens]
          Length = 948

 Score = 36.6 bits (83), Expect = 0.23
 Identities = 31/114 (27%), Positives = 43/114 (37%), Gaps = 3/114 (2%)
 Frame = -2

Query: 441 PPQTRSECSAESHNLGKTTKLGDPSISSSRSVAGRGRRQRRKSLASSRQNVNTGAARTFS 262
           P + R  CS E   L    + G P +  S    G   R+ R++++ S   V    A +  
Sbjct: 176 PTRARGTCSVEDPLLVCQKEPGKPRMVKSVGSVGDSPREPRRTVSESVIAVKASFASSAL 235

Query: 261 QFEYTCNTGRDL*FQSLATCPPAS*DSRTTAWAAVCHPTPSSD---PSRPVSSP 109
                   GR L   S+A+C P     R         P PS     P+RP S P
Sbjct: 236 PPRTGVALGRKLGSHSVASCAPQLLGDRRVDAGHTDQPVPSGSVGGPARPASGP 289

>ref|ZP_00053760.1| COG1167: Transcriptional regulators containing a DNA-binding HTH
           domain and an aminotransferase domain (MocR family) and
           their eukaryotic orthologs [Magnetospirillum
           magnetotacticum]
          Length = 491

 Score = 34.7 bits (78), Expect = 0.86
 Identities = 15/30 (50%), Positives = 18/30 (60%)
 Frame = -2

Query: 210 ATCPPAS*DSRTTAWAAVCHPTPSSDPSRP 121
           A  PP++  SRT  W+A   PT   DPSRP
Sbjct: 100 AAAPPSALPSRTVEWSAAPPPTQGRDPSRP 129

>ref|XP_085151.7| similar to Nuclear protein ZAP3 (ZAP113) [Homo sapiens]
          Length = 2192

 Score = 34.7 bits (78), Expect = 0.86
 Identities = 25/69 (36%), Positives = 34/69 (49%), Gaps = 9/69 (13%)
 Frame = -3

Query: 284 LALPEL-----LVSSSTLAIPA--GIYSFKASRLARLRHRTPAPQHGRRCAIPPHH--PT 132
           +ALPE        SS+T A P+  G  SF+   LA+L+      Q   +C + PHH  P 
Sbjct: 25  VALPEASPGPGYSSSTTPAAPSSSGFMSFREQHLAQLQQLQQMHQKQMQCVLQPHHLPPP 84

Query: 131 PLVPCHLHP 105
           PL P  + P
Sbjct: 85  PLPPPPVMP 93

>dbj|BAA09771.1| The KIAA0150 gene product is novel. [Homo sapiens]
          Length = 944

 Score = 34.7 bits (78), Expect = 0.86
 Identities = 30/114 (26%), Positives = 42/114 (36%), Gaps = 3/114 (2%)
 Frame = -2

Query: 441 PPQTRSECSAESHNLGKTTKLGDPSISSSRSVAGRGRRQRRKSLASSRQNVNTGAARTFS 262
           P + R  CS E   L    + G P +  S    G   R+ R++++ S   V      +  
Sbjct: 172 PTRARGTCSVEDPLLVCQKEPGKPRMVKSVGSVGDSPREPRRTVSESVIAVKASFPSSAL 231

Query: 261 QFEYTCNTGRDL*FQSLATCPPAS*DSRTTAWAAVCHPTPSSD---PSRPVSSP 109
                   GR L   S+A+C P     R         P PS     P+RP S P
Sbjct: 232 PPRTGVALGRKLGSHSVASCAPQLLGDRRVDAGHTDQPVPSGSVGGPARPASGP 285

>sp|P49750|ZAP3_HUMAN Nuclear protein ZAP3 (ZAP113) gi|7341427|gb|AAF61275.1|AC007956_1
           unknown [Homo sapiens]
          Length = 1822

 Score = 34.7 bits (78), Expect = 0.86
 Identities = 25/69 (36%), Positives = 34/69 (49%), Gaps = 9/69 (13%)
 Frame = -3

Query: 284 LALPEL-----LVSSSTLAIPA--GIYSFKASRLARLRHRTPAPQHGRRCAIPPHH--PT 132
           +ALPE        SS+T A P+  G  SF+   LA+L+      Q   +C + PHH  P 
Sbjct: 25  VALPEASPGPGYSSSTTPAAPSSSGFMSFREQHLAQLQQLQQMHQKQMQCVLQPHHLPPP 84

Query: 131 PLVPCHLHP 105
           PL P  + P
Sbjct: 85  PLPPPPVMP 93



EST assemble image


clone accession position
1 MX246e01_r BP091924 1 587
2 CL27a12_r AV394681 92 598
3 CM092a08_r AV392678 123 636




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research