KCC000412A_c02
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000412A_C02 KCC000412A_c02
CATTCACGCTCTAGTCAAAATGGCCATCCTCAGCGCTAAGCAGGTTAACGTTGCGGCCTC
GGCCCGCTCCGCCAAGGTGGTGGTGCCGATGGTTCCCCGGCGCTGCCGCCGGCCCCGTGG
CCCGCGGTGTCGCGGCTCGTGTCGCTGCCGCCCCTGGCGCCTGTGGTTGCTGCCAAGTCC
AGCCGTCGCAGCTCCGTGGTCGTTCGCGCGACCGCTGCCCCGGTCGCCCAGGTTCGCACC
GCTGAGGGCCTGCAGGTCCCCCACGGCCCCGCTGCCAAGCTGGTCAACCTGATGGCGCCT
GCCTCGGAGCACGCTGCCCTGAAGGCTGCCTGCAACAAGCGCATCGAGCTGAGCGACCGC
AACGCGTGCGACGTCGAGCTGCTGACCGTGGGCGCGTTCTCCCCCCTGGAGGGCTTCATG
AACAAGGCGGAGTACGACTCCGTCGTCGCCAACATGCGCATGACCAACGGCCTGCTGTTC
GGTCTGCCCATCGTGCTGGACACCGACTCGGAGGACATCGTGCCCGGCGACAAGCTGCTG
CTGACCTACCAGGGCCAGGACCTCGCGGTCATGACCGTGGACTCCAAGTTCACCCCCAAC
AAGCCGCTGGAGTGCCTCAAGTGCTACGGCACCTCCTCGCTGGAGCACCCTGCCGTGCAG
ATGGTGGCCATGGAGCGCGGCAAGTACTACATCGGCGGCCCCATCAAGGGCCTGGCCCTG
CCCACCCGCGTCTTCCCCTGCGCCTCGCCCGCCGACGTGCGCTCCACGCTGCCTGCCAAC
CAGGACGTGCTGGCCTTCCAGTGCCGCAACCCCATCCACAAGGCCCACTACGAGCTGTTC
ATTCGCGCGCTGGACGCGCCCAACGTGCGCAACCCCGGCGCCGTGTGCCTGGTGCACCCC
ACCTGCGGCCCCACCCAGGACGACGACATCCCCGGCGTGGTCCGCTTCCGCACCTATGAG
GTGCTGAAGGAGGAGACCAAGAACCCCCGCCTGCGCTGGGCCTACCTGCCCTACTCCATG
CACATGGCCGGCCCCCGTGAGGCCATCCAGCACATGATTATCCGCAAGAACTACGGCTGC
ACGCACTTCATCATCGGCCGCGACATGGCCGGCTGCAAGTCGTCCATCAGCGGACAGGAC
TTCTACGGCGCCTACGACGCCCAGGACCTGGCCAACAAGCACGCGGCGGAGCTGAACATG
CAGACCGTTGCCAGCCTCAACATCGCCTACACCGAGGAGAAGGGCTACGTCACCGCAGAC
ATCGCCAAGGCGGAGAACCTGCACGTGCTCAACCTGAGCGGCACCAAGTTCCGCCAGATG
CTGCGCGCCGGCGACGAC


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000412A_C02 KCC000412A_c02
         (1338 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

pir||T08094 probable sulfate adenylyltransferase (EC 2.7.7.4) AT...   774  0.0
ref|NP_896399.1| ATP-sulfurylase [Synechococcus sp. WH 8102] gi|...   494  e-138
ref|NP_895626.1| ATP-sulfurylase [Prochlorococcus marinus str. M...   489  e-137
ref|NP_874650.1| Sulfate adenylyltransferase [Prochlorococcus ma...   488  e-136
ref|NP_892347.1| ATP-sulfurylase [Prochlorococcus marinus subsp....   438  e-122

>pir||T08094 probable sulfate adenylyltransferase (EC 2.7.7.4) ATS1 -
            Chlamydomonas reinhardtii gi|1336213|gb|AAB01234.1| ATP
            sulfurylase Ats1
          Length = 437

 Score =  774 bits (1999), Expect(2) = 0.0
 Identities = 389/394 (98%), Positives = 389/394 (98%)
 Frame = +1

Query: 157  APVVAAKSSRRSSVVVRATAAPVAQVRTAEGLQVPHGPAAKLVNLMAPASEHAALKAACN 336
            APVVAAKSSRRSSVVVRATAAPVAQVRTAEGLQVPHGPAAKLVNLMAPASEHAALKAACN
Sbjct: 23   APVVAAKSSRRSSVVVRATAAPVAQVRTAEGLQVPHGPAAKLVNLMAPASEHAALKAACN 82

Query: 337  KRIELSDRNACDVELLTVGAFSPLEGFMNKAEYDSVVANMRMTNGLLFGLPIVLDTDSED 516
            KRIELSDR  CDVELLTVGAFSPLEGFMNKAEYDSVVANMRMTNGLLFGLPIVLDTDSED
Sbjct: 83   KRIELSDRT-CDVELLTVGAFSPLEGFMNKAEYDSVVANMRMTNGLLFGLPIVLDTDSED 141

Query: 517  IVPGDKLLLTYQGQDLAVMTVDSKFTPNKPLECLKCYGTSSLEHPAVQMVAMERGKYYIG 696
            IVPGDKLLLTYQGQDLAVMTVDSKFTPNKPLECLKCYGTSSLEHPAVQMVAMERGKYYIG
Sbjct: 142  IVPGDKLLLTYQGQDLAVMTVDSKFTPNKPLECLKCYGTSSLEHPAVQMVAMERGKYYIG 201

Query: 697  GPIKGLALPTRVFPCASPADVRSTLPANQDVLAFQCRNPIHKAHYELFIRALDAPNVRNP 876
            GPIKGLALPTRVFPCASPADVRSTLPANQDVLAFQCRNPIHKAHYELFIRALD  NVRNP
Sbjct: 202  GPIKGLALPTRVFPCASPADVRSTLPANQDVLAFQCRNPIHKAHYELFIRALDR-NVRNP 260

Query: 877  GAVCLVHPTCGPTQDDDIPGVVRFRTYEVLKEETKNPRLRWAYLPYSMHMAGPREAIQHM 1056
            GAVCLVHPTCGPTQDDDIPGVVRFRTYEVLKEETKNPRLRWAYLPYSMHMAGPREAIQHM
Sbjct: 261  GAVCLVHPTCGPTQDDDIPGVVRFRTYEVLKEETKNPRLRWAYLPYSMHMAGPREAIQHM 320

Query: 1057 IIRKNYGCTHFIIGRDMAGCKSSISGQDFYGAYDAQDLANKHAAELNMQTVASLNIAYTE 1236
            IIRKNYGCTHFIIGRDMAGCKSSISGQDFY AYDAQDLANKHAAELNMQTVASLNIAYTE
Sbjct: 321  IIRKNYGCTHFIIGRDMAGCKSSISGQDFYRAYDAQDLANKHAAELNMQTVASLNIAYTE 380

Query: 1237 EKGYVTADIAKAENLHVLNLSGTKFRQMLRAGDD 1338
            EKGYVTADIAKAENLHVLNLSGTKFRQMLRAGDD
Sbjct: 381  EKGYVTADIAKAENLHVLNLSGTKFRQMLRAGDD 414

 Score = 37.0 bits (84), Expect(2) = 0.0
 Identities = 18/20 (90%), Positives = 18/20 (90%)
 Frame = +3

Query: 96  PGAAAGPVARGVAARVAAAP 155
           P AAAGPVARGVAARV AAP
Sbjct: 3   PRAAAGPVARGVAARVRAAP 22

>ref|NP_896399.1| ATP-sulfurylase [Synechococcus sp. WH 8102]
            gi|33632363|emb|CAE06819.1| ATP-sulfurylase
            [Synechococcus sp. WH 8102]
          Length = 390

 Score =  494 bits (1273), Expect = e-138
 Identities = 239/375 (63%), Positives = 296/375 (78%)
 Frame = +1

Query: 214  AAPVAQVRTAEGLQVPHGPAAKLVNLMAPASEHAALKAACNKRIELSDRNACDVELLTVG 393
            +AP +  R+  G+  P+G    LV+LM P  E  A+KA   K +E SDRNACDVELL VG
Sbjct: 4    SAPASAQRS--GVIAPYG--GSLVDLMVPQEEREAVKATTTKSLECSDRNACDVELLVVG 59

Query: 394  AFSPLEGFMNKAEYDSVVANMRMTNGLLFGLPIVLDTDSEDIVPGDKLLLTYQGQDLAVM 573
             FSPL GFM++ +YD+VV+  R+  G LFGLPIV+DTD ED+V GD +LLTY+GQ+LAV+
Sbjct: 60   GFSPLRGFMHQEDYDAVVSGHRLVAGQLFGLPIVMDTDREDVVVGDTVLLTYKGQNLAVL 119

Query: 574  TVDSKFTPNKPLECLKCYGTSSLEHPAVQMVAMERGKYYIGGPIKGLALPTRVFPCASPA 753
             V++K+ PNK +E   CYGT+S+EHPAV+M+ MER ++Y+GG + GL LP RVFPC +PA
Sbjct: 120  QVEAKWEPNKVVEAKGCYGTTSIEHPAVRMITMERKRFYLGGSLNGLELPQRVFPCKTPA 179

Query: 754  DVRSTLPANQDVLAFQCRNPIHKAHYELFIRALDAPNVRNPGAVCLVHPTCGPTQDDDIP 933
            +VR+ LP  +DV+AFQCRNPIH+AHYELF RAL A NV +  AV LVHPTCGPTQ DDIP
Sbjct: 180  EVRAGLPDGEDVVAFQCRNPIHRAHYELFTRALHAQNV-SENAVVLVHPTCGPTQQDDIP 238

Query: 934  GVVRFRTYEVLKEETKNPRLRWAYLPYSMHMAGPREAIQHMIIRKNYGCTHFIIGRDMAG 1113
            G VRF+TYE L  E  N R+RWAYLPY+MHMAGPREA+QHMIIR+NYGCTHFIIGRDMAG
Sbjct: 239  GAVRFQTYERLAAEVNNDRIRWAYLPYAMHMAGPREALQHMIIRRNYGCTHFIIGRDMAG 298

Query: 1114 CKSSISGQDFYGAYDAQDLANKHAAELNMQTVASLNIAYTEEKGYVTADIAKAENLHVLN 1293
            CKSS++G DFYG YDAQ+ A + A EL M+TV SLN+ YTEE+GYVTA+ A+A  LHV  
Sbjct: 299  CKSSLTGDDFYGPYDAQNFAKECAPELTMETVPSLNLVYTEEEGYVTAEHAEARGLHVKK 358

Query: 1294 LSGTKFRQMLRAGDD 1338
            LSGT+FR+MLR G++
Sbjct: 359  LSGTQFRKMLRGGEE 373

>ref|NP_895626.1| ATP-sulfurylase [Prochlorococcus marinus str. MIT 9313]
            gi|33635650|emb|CAE21974.1| ATP-sulfurylase
            [Prochlorococcus marinus str. MIT 9313]
          Length = 390

 Score =  489 bits (1260), Expect = e-137
 Identities = 237/375 (63%), Positives = 298/375 (79%)
 Frame = +1

Query: 214  AAPVAQVRTAEGLQVPHGPAAKLVNLMAPASEHAALKAACNKRIELSDRNACDVELLTVG 393
            A+P A  ++  G+  P+G   KLV+LM    +  A+KA+ N  +E SDRNACD+ELL  G
Sbjct: 3    ASPSASAQSP-GVIAPYG--GKLVDLMVATDQQEAVKASANYVLECSDRNACDLELLVGG 59

Query: 394  AFSPLEGFMNKAEYDSVVANMRMTNGLLFGLPIVLDTDSEDIVPGDKLLLTYQGQDLAVM 573
             FSP  GFM++ +YD+VVA  R  +G LFGLPIV+DTD ED+  GD++LL+Y+GQDLAV+
Sbjct: 60   GFSPERGFMHQGDYDAVVAGHRTLSGYLFGLPIVMDTDREDVAIGDRVLLSYKGQDLAVL 119

Query: 574  TVDSKFTPNKPLECLKCYGTSSLEHPAVQMVAMERGKYYIGGPIKGLALPTRVFPCASPA 753
             V+ K+ P+K +E   CYGT+SLEHPAV+M+A ER ++Y+GG ++GL LP R+FPC SPA
Sbjct: 120  QVEDKWEPDKVVEAKGCYGTTSLEHPAVRMIATERKRFYLGGTLQGLELPKRIFPCKSPA 179

Query: 754  DVRSTLPANQDVLAFQCRNPIHKAHYELFIRALDAPNVRNPGAVCLVHPTCGPTQDDDIP 933
             VR+ LPA +DV+AFQCRNPIH+AHYELF RAL A NV +  AV LVHPTCGPTQ+DDIP
Sbjct: 180  QVRAELPAGEDVVAFQCRNPIHRAHYELFTRALHASNV-SENAVVLVHPTCGPTQEDDIP 238

Query: 934  GVVRFRTYEVLKEETKNPRLRWAYLPYSMHMAGPREAIQHMIIRKNYGCTHFIIGRDMAG 1113
            G VRF+TYE L  E  NPR+RWAYLPY+MHMAGPREA+QHMIIR+NYGCTHFIIGRDMAG
Sbjct: 239  GGVRFQTYERLAAEVDNPRIRWAYLPYAMHMAGPREALQHMIIRRNYGCTHFIIGRDMAG 298

Query: 1114 CKSSISGQDFYGAYDAQDLANKHAAELNMQTVASLNIAYTEEKGYVTADIAKAENLHVLN 1293
            CKSS+SG DFYG YDAQ+ A + A EL M+TV SLN+ +TEE+GYVTA+ A+A  LHV  
Sbjct: 299  CKSSLSGDDFYGPYDAQNFAQECAVELAMETVPSLNLVFTEEEGYVTAEHAEARGLHVKK 358

Query: 1294 LSGTKFRQMLRAGDD 1338
            LSGT+FR+MLR+G++
Sbjct: 359  LSGTQFRKMLRSGEE 373

>ref|NP_874650.1| Sulfate adenylyltransferase [Prochlorococcus marinus subsp. marinus
            str. CCMP1375] gi|33237233|gb|AAP99302.1| Sulfate
            adenylyltransferase [Prochlorococcus marinus subsp.
            marinus str. CCMP1375]
          Length = 390

 Score =  488 bits (1255), Expect = e-136
 Identities = 231/360 (64%), Positives = 289/360 (80%)
 Frame = +1

Query: 259  PHGPAAKLVNLMAPASEHAALKAACNKRIELSDRNACDVELLTVGAFSPLEGFMNKAEYD 438
            P+G    L NLM P++   A+K + +K+I+ SDRNACD+ELL +G FSPL+GFMN+ +YD
Sbjct: 17   PYG--GTLQNLMVPSNSQEAIKQSASKKIDCSDRNACDIELLLIGGFSPLQGFMNQKDYD 74

Query: 439  SVVANMRMTNGLLFGLPIVLDTDSEDIVPGDKLLLTYQGQDLAVMTVDSKFTPNKPLECL 618
            SVV + R  +G LFGLPIVLDTD ED+  GDK+LL Y+ Q LAV+T++ K+ P+K LE  
Sbjct: 75   SVVNSNRTADGKLFGLPIVLDTDREDLKIGDKVLLCYKNQSLAVLTIEDKWLPDKVLEAK 134

Query: 619  KCYGTSSLEHPAVQMVAMERGKYYIGGPIKGLALPTRVFPCASPADVRSTLPANQDVLAF 798
             CYGT+SLEHPAV+M+A+ER K+Y+ G ++GL LP R+FPC +P++VR  LP NQDV+AF
Sbjct: 135  GCYGTTSLEHPAVKMIAIERKKFYLAGKLEGLELPKRIFPCKTPSEVRKELPHNQDVVAF 194

Query: 799  QCRNPIHKAHYELFIRALDAPNVRNPGAVCLVHPTCGPTQDDDIPGVVRFRTYEVLKEET 978
            QCRNPIH+AHYELF +AL A NV + GAV LVHPTCGPTQ DDIPG +RF TYE L  E 
Sbjct: 195  QCRNPIHRAHYELFTQALHAENV-SKGAVVLVHPTCGPTQQDDIPGSIRFATYERLAAEV 253

Query: 979  KNPRLRWAYLPYSMHMAGPREAIQHMIIRKNYGCTHFIIGRDMAGCKSSISGQDFYGAYD 1158
            KNP +RWAYLPYSMHMAGPREA+QHMIIR+NYGC+HFIIGRDMAGCKS ++G+DFYG YD
Sbjct: 254  KNPMIRWAYLPYSMHMAGPREALQHMIIRRNYGCSHFIIGRDMAGCKSQLTGEDFYGPYD 313

Query: 1159 AQDLANKHAAELNMQTVASLNIAYTEEKGYVTADIAKAENLHVLNLSGTKFRQMLRAGDD 1338
            AQ+ A   A+EL MQTV SLN+ YTEE+GYVTAD A++  LH+  LSGT+FR+MLR  ++
Sbjct: 314  AQEFAKACASELEMQTVPSLNLVYTEEEGYVTADHAQSCGLHIKKLSGTQFRKMLRNNEE 373

>ref|NP_892347.1| ATP-sulfurylase [Prochlorococcus marinus subsp. pastoris str.
            CCMP1378] gi|33633728|emb|CAE18686.1| ATP-sulfurylase
            [Prochlorococcus marinus subsp. pastoris str. CCMP1986]
          Length = 391

 Score =  438 bits (1127), Expect = e-122
 Identities = 211/330 (63%), Positives = 258/330 (77%)
 Frame = +1

Query: 346  ELSDRNACDVELLTVGAFSPLEGFMNKAEYDSVVANMRMTNGLLFGLPIVLDTDSEDIVP 525
            E SDRNACD+ELL VG FSPLEGFM+K EY SV+ + R T GLLFGLPIV DT++  I  
Sbjct: 45   ECSDRNACDIELLMVGGFSPLEGFMDKEEYKSVIKSHRDTKGLLFGLPIVFDTNNAQIKE 104

Query: 526  GDKLLLTYQGQDLAVMTVDSKFTPNKPLECLKCYGTSSLEHPAVQMVAMERGKYYIGGPI 705
             + +LLTY+ Q LA++ V SK+ P+K  E   CYGT+SL+HPAV+M+  ERG+YYIGG +
Sbjct: 105  DETILLTYKKQKLAILKVSSKWEPDKAEEAEFCYGTNSLDHPAVKMIFNERGRYYIGGKV 164

Query: 706  KGLALPTRVFPCASPADVRSTLPANQDVLAFQCRNPIHKAHYELFIRALDAPNVRNPGAV 885
             GL LP R FPC +P +VR  LPAN DV+AFQCRNPIH+AHYELF  AL + NV +  +V
Sbjct: 165  YGLELPNRDFPCKTPKEVRDLLPANFDVVAFQCRNPIHRAHYELFTNALQSENV-SSNSV 223

Query: 886  CLVHPTCGPTQDDDIPGVVRFRTYEVLKEETKNPRLRWAYLPYSMHMAGPREAIQHMIIR 1065
             LVHPTCGPTQ DDIPG VR+ TY+ L+EE  N +++WA+LPYSMHMAGPREA+QHMIIR
Sbjct: 224  VLVHPTCGPTQQDDIPGKVRYLTYKKLEEEISNKKIKWAFLPYSMHMAGPREALQHMIIR 283

Query: 1066 KNYGCTHFIIGRDMAGCKSSISGQDFYGAYDAQDLANKHAAELNMQTVASLNIAYTEEKG 1245
            +NYGCTHFIIGRDMAGCKSS +G+DFYG YDAQ  AN+ A EL M+TV S N+ YT EKG
Sbjct: 284  RNYGCTHFIIGRDMAGCKSSSTGEDFYGPYDAQTFANECAEELLMKTVPSKNLVYTIEKG 343

Query: 1246 YVTADIAKAENLHVLNLSGTKFRQMLRAGD 1335
            Y+TA+ AK +   ++ LSGT+FR+ LR GD
Sbjct: 344  YITAEEAKEKKYQIMKLSGTEFRKKLRNGD 373



EST assemble image


clone accession position
1 MX227c10_r BP090672 1 406
2 HC043g06_r AV635242 3 577
3 HC051d07_r AV635821 12 643
4 HCL044b10_r AV642027 104 410
5 LCL099h11_r AV631792 104 620
6 LCL048b12_r AV628865 105 308
7 HCL041b10_r AV641842 105 620
8 CM047b11_r AV388560 106 334
9 HC085c02_r AV638346 108 218
10 HC072f12_r AV637400 110 555
11 HCL019e05_r AV640630 111 410
12 HC030d12_r AV634201 111 613
13 CL26h11_r AV394594 111 642
14 HC025h07_r AV633836 111 608
15 MXL065d03_r BP096817 111 579
16 MX213e09_r BP089765 112 566
17 LCL057b07_r AV629352 112 536
18 HC034h06_r AV634555 112 598
19 HCL006f01_r AV639880 112 634
20 HC024h01_r AV633754 113 625
21 MXL078g12_r BP097636 113 485
22 MX061f12_r BP088490 114 473
23 HC028a06_r AV634006 114 633
24 HC071e12_r AV637318 115 551
25 HC012b02_r AV632749 115 640
26 HC054f02_r AV636053 116 545
27 HC097f10_r AV639309 116 538
28 HC072f03_r AV637395 116 647
29 MX022e11_r BP087000 116 499
30 MX008f03_r BP086427 116 526
31 HC086h07_r AV638479 116 525
32 MX236c07_r BP091273 117 565
33 HCL041c12_r AV641850 121 573
34 HC073g04_r AV637488 121 532
35 HCL037f10_r AV641625 121 640
36 HC054c01_r AV636028 122 620
37 HC034h11_r AV634560 124 633
38 HC070h10_r AV637272 126 559
39 HC094f04_r AV639070 130 638
40 CM100g04_r AV392847 136 637
41 MXL087g08_r BP098131 136 512
42 HC080e10_r AV638007 141 482
43 HCL079g10_r AV643994 151 574
44 HCL095a08_r AV644879 217 687
45 HC063c12_r AV636718 318 881
46 HC060f01_r AV636522 326 626
47 MXL001h03_r BP092989 353 790
48 HC093g05_r AV639008 358 771
49 HC064f08_r AV636820 452 1020
50 LC052a08_r AV622621 469 976
51 HCL012f09_r AV640234 479 747
52 HC095e06_r AV639143 515 987
53 MX053h08_r BP088202 549 976
54 HC036h01_r AV634711 580 1086
55 HC015b03_r AV632978 624 1096
56 HC033h11_r AV634480 636 1180
57 HC031f04_r AV634300 751 1223
58 CM037g04_r AV388885 763 1272
59 HC095e07_r AV639144 790 1218
60 CM059e07_r AV390689 804 1136
61 HC072g08_r AV637407 804 1253
62 MX208a12_r BP089479 810 1059
63 CM029a03_r AV389356 814 1408
64 HC053f05_r AV635981 816 1194
65 HC048f09_r AV635623 829 1301
66 HC085g01_r AV638385 851 1285
67 CM074g08_r AV391537 861 1453
68 CM062e04_r AV390172 879 1468
69 HC021a03_r AV633453 893 1312
70 HC030d04_r AV634194 896 1377
71 MX066g11_r BP088700 902 1330
72 HC072g03_r AV637402 935 1381
73 HC055h07_r AV636157 944 1401
74 HC031f12_r AV634305 946 1450
75 HC093a12_r AV638956 956 1368
76 CM009c08_r AV397672 963 1527




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research