KCC000411A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000411A_C01 KCC000411A_c01
ctcggggaattgACCGGCAATTCTTCAAGCAATAAACAGGAATACCAATTATTAAAAGAT
AACTTAGTCAGATCGTACAATAAAGCTTTGAAGAAAAATGCGCCTTATTCAATCTTTGCT
ATAAAAAATGGCCCAAAATCTCACATTGGAAGACATTTGATGACCTCATTTCTTTCAATG
AAGGGCCTAACGGAGTTGACTAATGTTGTGGGAAATTGGAGCGATAAGCGTGCTTCTGCC
GTGGCCAGGACAACGTATACTCATCAGATAACAGCAATACCTGATCACTACTTCGCACTA
GTTTCACGGTACTATGCATATGATCCAATATCAAAGGAAATGATAGCATTGAAGGATGAG
ACTAATCCAATTGAGGAGTGGCAGCATATAGAACAGCTAAAGGGTAGTGCTGAAGGAAGC
ATACGATACCCCGCATGGAATGGGATAATATCACAGGAGGTACTAGACTACCTTTCATCC
TACATAAATAGACGCATATAAGTACGC


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000411A_C01 KCC000411A_c01
         (507 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

pdb|1FLO|A Chain A, Flp Recombinase-Holliday Junction Complex I ...   329  1e-89
pir||PDBYA site-specific recombinase FLP - yeast (Saccharomyces ...   329  1e-89
gb|AAC53669.1| Flp recombinase                                        329  1e-89
ref|NP_040488.1| FLP recombinase [Saccharomyces cerevisiae] gi|1...   329  1e-89
pdb|1M6X|A Chain A, Flpe-Holliday Junction Complex gi|28373602|p...   327  5e-89

>pdb|1FLO|A Chain A, Flp Recombinase-Holliday Junction Complex I
           gi|10120586|pdb|1FLO|B Chain B, Flp Recombinase-Holliday
           Junction Complex I gi|10120587|pdb|1FLO|C Chain C, Flp
           Recombinase-Holliday Junction Complex I
           gi|10120588|pdb|1FLO|D Chain D, Flp Recombinase-Holliday
           Junction Complex I
          Length = 422

 Score =  329 bits (843), Expect = 1e-89
 Identities = 162/162 (100%), Positives = 162/162 (100%)
 Frame = +1

Query: 13  TGNSSSNKQEYQLLKDNLVRSYNKALKKNAPYSIFAIKNGPKSHIGRHLMTSFLSMKGLT 192
           TGNSSSNKQEYQLLKDNLVRSYNKALKKNAPYSIFAIKNGPKSHIGRHLMTSFLSMKGLT
Sbjct: 261 TGNSSSNKQEYQLLKDNLVRSYNKALKKNAPYSIFAIKNGPKSHIGRHLMTSFLSMKGLT 320

Query: 193 ELTNVVGNWSDKRASAVARTTYTHQITAIPDHYFALVSRYYAYDPISKEMIALKDETNPI 372
           ELTNVVGNWSDKRASAVARTTYTHQITAIPDHYFALVSRYYAYDPISKEMIALKDETNPI
Sbjct: 321 ELTNVVGNWSDKRASAVARTTYTHQITAIPDHYFALVSRYYAYDPISKEMIALKDETNPI 380

Query: 373 EEWQHIEQLKGSAEGSIRYPAWNGIISQEVLDYLSSYINRRI 498
           EEWQHIEQLKGSAEGSIRYPAWNGIISQEVLDYLSSYINRRI
Sbjct: 381 EEWQHIEQLKGSAEGSIRYPAWNGIISQEVLDYLSSYINRRI 422

>pir||PDBYA site-specific recombinase FLP - yeast (Saccharomyces cerevisiae)
           plasmid 2-mu
          Length = 423

 Score =  329 bits (843), Expect = 1e-89
 Identities = 162/162 (100%), Positives = 162/162 (100%)
 Frame = +1

Query: 13  TGNSSSNKQEYQLLKDNLVRSYNKALKKNAPYSIFAIKNGPKSHIGRHLMTSFLSMKGLT 192
           TGNSSSNKQEYQLLKDNLVRSYNKALKKNAPYSIFAIKNGPKSHIGRHLMTSFLSMKGLT
Sbjct: 262 TGNSSSNKQEYQLLKDNLVRSYNKALKKNAPYSIFAIKNGPKSHIGRHLMTSFLSMKGLT 321

Query: 193 ELTNVVGNWSDKRASAVARTTYTHQITAIPDHYFALVSRYYAYDPISKEMIALKDETNPI 372
           ELTNVVGNWSDKRASAVARTTYTHQITAIPDHYFALVSRYYAYDPISKEMIALKDETNPI
Sbjct: 322 ELTNVVGNWSDKRASAVARTTYTHQITAIPDHYFALVSRYYAYDPISKEMIALKDETNPI 381

Query: 373 EEWQHIEQLKGSAEGSIRYPAWNGIISQEVLDYLSSYINRRI 498
           EEWQHIEQLKGSAEGSIRYPAWNGIISQEVLDYLSSYINRRI
Sbjct: 382 EEWQHIEQLKGSAEGSIRYPAWNGIISQEVLDYLSSYINRRI 423

>gb|AAC53669.1| Flp recombinase
          Length = 423

 Score =  329 bits (843), Expect = 1e-89
 Identities = 162/162 (100%), Positives = 162/162 (100%)
 Frame = +1

Query: 13  TGNSSSNKQEYQLLKDNLVRSYNKALKKNAPYSIFAIKNGPKSHIGRHLMTSFLSMKGLT 192
           TGNSSSNKQEYQLLKDNLVRSYNKALKKNAPYSIFAIKNGPKSHIGRHLMTSFLSMKGLT
Sbjct: 262 TGNSSSNKQEYQLLKDNLVRSYNKALKKNAPYSIFAIKNGPKSHIGRHLMTSFLSMKGLT 321

Query: 193 ELTNVVGNWSDKRASAVARTTYTHQITAIPDHYFALVSRYYAYDPISKEMIALKDETNPI 372
           ELTNVVGNWSDKRASAVARTTYTHQITAIPDHYFALVSRYYAYDPISKEMIALKDETNPI
Sbjct: 322 ELTNVVGNWSDKRASAVARTTYTHQITAIPDHYFALVSRYYAYDPISKEMIALKDETNPI 381

Query: 373 EEWQHIEQLKGSAEGSIRYPAWNGIISQEVLDYLSSYINRRI 498
           EEWQHIEQLKGSAEGSIRYPAWNGIISQEVLDYLSSYINRRI
Sbjct: 382 EEWQHIEQLKGSAEGSIRYPAWNGIISQEVLDYLSSYINRRI 423

>ref|NP_040488.1| FLP recombinase [Saccharomyces cerevisiae]
           gi|120357|sp|P03870|FLP_YEAST Recombinase FLP protein
           (Protein Able) gi|172191|gb|AAB59340.1| recombinase
           (FLP) [Saccharomyces cerevisiae]
           gi|2961155|gb|AAC27032.1| Flp recombinase [site-specific
           excision vector pFLP2]
          Length = 423

 Score =  329 bits (843), Expect = 1e-89
 Identities = 162/162 (100%), Positives = 162/162 (100%)
 Frame = +1

Query: 13  TGNSSSNKQEYQLLKDNLVRSYNKALKKNAPYSIFAIKNGPKSHIGRHLMTSFLSMKGLT 192
           TGNSSSNKQEYQLLKDNLVRSYNKALKKNAPYSIFAIKNGPKSHIGRHLMTSFLSMKGLT
Sbjct: 262 TGNSSSNKQEYQLLKDNLVRSYNKALKKNAPYSIFAIKNGPKSHIGRHLMTSFLSMKGLT 321

Query: 193 ELTNVVGNWSDKRASAVARTTYTHQITAIPDHYFALVSRYYAYDPISKEMIALKDETNPI 372
           ELTNVVGNWSDKRASAVARTTYTHQITAIPDHYFALVSRYYAYDPISKEMIALKDETNPI
Sbjct: 322 ELTNVVGNWSDKRASAVARTTYTHQITAIPDHYFALVSRYYAYDPISKEMIALKDETNPI 381

Query: 373 EEWQHIEQLKGSAEGSIRYPAWNGIISQEVLDYLSSYINRRI 498
           EEWQHIEQLKGSAEGSIRYPAWNGIISQEVLDYLSSYINRRI
Sbjct: 382 EEWQHIEQLKGSAEGSIRYPAWNGIISQEVLDYLSSYINRRI 423

>pdb|1M6X|A Chain A, Flpe-Holliday Junction Complex gi|28373602|pdb|1M6X|B
           Chain B, Flpe-Holliday Junction Complex
          Length = 423

 Score =  327 bits (838), Expect = 5e-89
 Identities = 161/162 (99%), Positives = 161/162 (99%)
 Frame = +1

Query: 13  TGNSSSNKQEYQLLKDNLVRSYNKALKKNAPYSIFAIKNGPKSHIGRHLMTSFLSMKGLT 192
           TGNSSSNKQEYQLLKDNLVRSYNKALKKNAPY IFAIKNGPKSHIGRHLMTSFLSMKGLT
Sbjct: 262 TGNSSSNKQEYQLLKDNLVRSYNKALKKNAPYPIFAIKNGPKSHIGRHLMTSFLSMKGLT 321

Query: 193 ELTNVVGNWSDKRASAVARTTYTHQITAIPDHYFALVSRYYAYDPISKEMIALKDETNPI 372
           ELTNVVGNWSDKRASAVARTTYTHQITAIPDHYFALVSRYYAYDPISKEMIALKDETNPI
Sbjct: 322 ELTNVVGNWSDKRASAVARTTYTHQITAIPDHYFALVSRYYAYDPISKEMIALKDETNPI 381

Query: 373 EEWQHIEQLKGSAEGSIRYPAWNGIISQEVLDYLSSYINRRI 498
           EEWQHIEQLKGSAEGSIRYPAWNGIISQEVLDYLSSYINRRI
Sbjct: 382 EEWQHIEQLKGSAEGSIRYPAWNGIISQEVLDYLSSYINRRI 423



EST assemble image


clone accession position
1 CL26g06_r AV394589 1 465
2 CL34h07_r AV394936 13 507




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research