KCC000410A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000410A_C01 KCC000410A_c01
gagagagagagagagagaactagtctcgagtttttttttttttttttttaagccatccgt
gGCTTACACAGCTCGCGGCGGCGTGGAAGCCTCCCGAACACATGCGCCTTGAGCGCAGTC
GATAGGCACTACCGTATCACACCCACTCGGCTGCAGGCCGCGGTAACCGCCACAATTAGG
TGCAGCATCAAGAAGGTGGACACGCAGGAAGCCGTCTTGCCTCACCACCAAGCATCACAG
GTGCACCCCTTAACAATGAAACCTGCTACGACAACTAGGCGCTATCTCTTGTGGATCAGT
ACCGGCCCTGTGGCCTGAGCGCGACTGTCAATCCCCACACCACAGCAATGTGTGCAACCA
CGCACTGTGCCTCGGCATCCACTTCCAGTGCTTTGGCTATATCCGCGGCAATGAATCTCT
GGCTACACGGTACCGTTTACACCTTGAGGCAACGTAGGTCTTCTTCATTAGTCACGCATG
CAGGTGCTGATCCTTCCAGCCGTCGGCTTTCGCAGGTCCGCTCCTTCTCA


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000410A_C01 KCC000410A_c01
         (530 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|NP_870908.1| sensory transduction histidine kinase [Pirellul...    35  0.79
gb|AAQ23623.1| GM01353p [Drosophila melanogaster]                      33  1.8
ref|ZP_00093803.1| hypothetical protein [Novosphingobium aromati...    33  2.3
ref|XP_285267.1| similar to hypothetical protein FLJ39106 [Homo ...    33  3.0
ref|ZP_00004761.1| COG0624: Acetylornithine deacetylase/Succinyl...    32  3.9

>ref|NP_870908.1| sensory transduction histidine kinase [Pirellula sp.]
           gi|32448471|emb|CAD77986.1| sensory transduction
           histidine kinase [Pirellula sp.]
          Length = 953

 Score = 34.7 bits (78), Expect = 0.79
 Identities = 17/48 (35%), Positives = 25/48 (51%)
 Frame = +1

Query: 142 PTRLQAAVTATIRCSIKKVDTQEAVLPHHQASQVHPLTMKPATTTRRY 285
           P++LQ+ V  T R   + VDT   + P  QAS   P     +T+TR +
Sbjct: 719 PSKLQSPVAGTCRLIFQIVDTGIGIKPEDQASLFEPFVQADSTSTRSF 766

>gb|AAQ23623.1| GM01353p [Drosophila melanogaster]
          Length = 1124

 Score = 33.5 bits (75), Expect = 1.8
 Identities = 37/135 (27%), Positives = 60/135 (44%), Gaps = 3/135 (2%)
 Frame = +3

Query: 72  LAAAWKPPEHMRLERSR*ALPYHTHSAAGRGNRHN*VQHQEGGHAGSRLASPPSITGAPL 251
           +A A  PP H  ++R +   P     A+      +  Q    G +GS  A+    +G+  
Sbjct: 18  VAEAVAPPPHPDVQRRQHQPPDLLQGASSSAEYFDSGQ----GASGSSGAASSGFSGSFY 73

Query: 252 NNETCYDN*ALSLV--DQYRPCGLSATVNPHTTAMCATTHCASASTSSALAISAAMNLW- 422
           N     D    S     Q  P  L A+    + + CAT   ++ASTS+A A +A+ +   
Sbjct: 74  NALQMMDTTESSGAGTSQSTPPALGASSTTASKSTCATVGSSTASTSAAAAAAASASAGS 133

Query: 423 LHGTVYTLRQRRSSS 467
            H + Y LR++ S+S
Sbjct: 134 SHQSPYDLRRKISAS 148

>ref|ZP_00093803.1| hypothetical protein [Novosphingobium aromaticivorans]
          Length = 483

 Score = 33.1 bits (74), Expect = 2.3
 Identities = 17/46 (36%), Positives = 29/46 (62%)
 Frame = +3

Query: 282 LSLVDQYRPCGLSATVNPHTTAMCATTHCASASTSSALAISAAMNL 419
           L+LVD  +   ++   +  ++A+ ATT  ++A+  +ALAI AA NL
Sbjct: 29  LALVDDRKEAVVNMADSVESSALLATTQASTATAQAALAIGAATNL 74

>ref|XP_285267.1| similar to hypothetical protein FLJ39106 [Homo sapiens] [Mus
           musculus]
          Length = 293

 Score = 32.7 bits (73), Expect = 3.0
 Identities = 16/44 (36%), Positives = 25/44 (56%)
 Frame = +3

Query: 312 GLSATVNPHTTAMCATTHCASASTSSALAISAAMNLWLHGTVYT 443
           GL+ T +P TTA  ATT    AST++ +A+++   +    T  T
Sbjct: 148 GLATTTSPETTATTATTAPTEASTTTTMAVTSTQPVTTTATTTT 191

>ref|ZP_00004761.1| COG0624: Acetylornithine deacetylase/Succinyl-diaminopimelate
           desuccinylase and related deacylases [Rhodobacter
           sphaeroides]
          Length = 793

 Score = 32.3 bits (72), Expect = 3.9
 Identities = 24/61 (39%), Positives = 30/61 (48%), Gaps = 1/61 (1%)
 Frame = -2

Query: 232 LGGEARRLPACPPS*CCT*LWRLPRPAAEWV*YGSAYRL-RSRRMCSGGFHAAASCVSHG 56
           LG ++R  PA           RL     +WV  G+A R  + RRM SGG H AA+  S G
Sbjct: 702 LGTQSRSQPA-----------RLSPAMIDWVAGGAARRGDQPRRMLSGGGHDAAAFASAG 750

Query: 55  W 53
           W
Sbjct: 751 W 751



EST assemble image


clone accession position
1 LCL012a09_r AV626595 1 446
2 CL26f10_r AV394624 62 530




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research