KCC000409A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000409A_C01 KCC000409A_c01
GCTTGAGCTCAGTCGTGCCGACTCGTTGTTGCTGTACCATCACCAAACCACCAATCAAAA
TGGCCCTGTCGATGCGCACCCTGTCTGCCCGCACCGCGGCTCCTCGCGGCTTCTCGGGCC
GCCGCGTCGCTGCCGTCTCCAACGGGCAGCCGCGTGACCATGAAGGCCGGCAACTGGCTG
CCCGGCTCGGACGCCCCCGTGCTGGCTGCCCGATGACCTGCCGGGCAACTACGGCTTCGA
CCCCCTGGTCTCTGGGCAAGGAGCCTGCTTCCCTGAAGCCGCTTCACCGAGAGCGAGGTC
ATCCACGGTCGCTGGGCCATGCTGGGCGTTGCCGGCTCCCTGGCTGTGGAGCTGCTGGGC
TACGGCAACTGGTACGATGCCCCCCTGTGGGCCCGTGAACGGCGGCAAGGCCACCTGGTT
CGGCATTGAGGTGCCCTTCGACCTGAACGCCCTGCTGGCCTTCGAGTTCGTTGCCATGGC
CGCTGCTGAGGGCCAGCGCGGCGATGCCGGCGGCGTCGTCTACCCCGGCGGTGCCTTCGA
CCCCCTGGGCTTCGCCAAGGACTCGTCCAAGTCGGGTGAGCTGAAGCTGAAGGAGATCAA
GAACGGCCGCCTGGCCATGGTTGCTTTCCTGGGCTTCGTTGCCCAGCACGCCGCCACCGG
CAAGGGCCCCATTGCTGCCCTGGGCGAGCACCTGGCCAACCCTTGGGGCGCCAACTTTGC
CACCAACGGCATCTCCGTCCCCTTCTTCTAAATGCACACTCCCAGACACTTCTTGTGTTG
ACTAAAGCCACATGCAAATGATCTCCTGATAGCGGGAGATTGCATAGCATGCGGATGACA
CCAGAGGACCAGCGGACGGGCTTCACGGCTCCAAGGGGGGTGGCGAAGCGCGCTGGTCCT
TCCGTGTATGTAACTTTGTTAGTGGCCCGTATGGGCATAATTTTGGTGTGAGCAACGTGA
GAGCAAGGGTATGGTGGTGAAATGCTTCCCGAGCGCGGATGTGTTGGTTGGTCTTGTGGT
GGTTGGTGGGCCGGATGGCCCGTTTATGTGGAGGGTGCGGCGAGAGCTGCGATACGGTGT
GTGCGCACGGTCTACACGAACAGCAGGGCTTCGTGCCATTCCGTGTAACACGCAAGAAAC
TGAAAAAAAAAAAAAAAAACTCGAgactagttctcttc


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000409A_C01 KCC000409A_c01
         (1178 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

gb|AAD03734.1| light harvesting complex I protein precursor [Chl...   272  9e-72
gb|AAD03733.1| light harvesting complex I protein precursor [Chl...   272  9e-72
pir||S31845 chlorophyll a/b-binding protein I-20 precursor - Chl...   272  9e-72
gb|AAG28464.1|AF195794_1 chlorophyll A-B binding protein of LHCI...   218  2e-55
pir||PQ0764 chlorophyll a/b-binding protein type Ib, 21K chain p...   109  5e-36

>gb|AAD03734.1| light harvesting complex I protein precursor [Chlamydomonas
           reinhardtii]
          Length = 228

 Score =  272 bits (695), Expect = 9e-72
 Identities = 145/196 (73%), Positives = 150/196 (75%), Gaps = 7/196 (3%)
 Frame = +2

Query: 182 PARTPPCWLPDDLPGNYGFDPLVSGQGACFPEAASPRARSSTVAGPCWALPAPWLWSCWA 361
           P    P WLPDDLPGNYGFDPL  G+      A+  R   S V    WA+    L    +
Sbjct: 41  PGSDAPAWLPDDLPGNYGFDPLSLGK----EPASLKRFTESEVIHGRWAM----LGVAGS 92

Query: 362 TATGTM-------PPCGPVNGGKATWFGIEVPFDLNALLAFEFVAMAAAEGQRGDAGGVV 520
            A   +        P   VNGGKATWFGIEVPFDLNALLAFEFVAMAAAEGQRGDAGGVV
Sbjct: 93  LAVELLGYGNWYDAPLWAVNGGKATWFGIEVPFDLNALLAFEFVAMAAAEGQRGDAGGVV 152

Query: 521 YPGGAFDPLGFAKDSSKSGELKLKEIKNGRLAMVAFLGFVAQHAATGKGPIAALGEHLAN 700
           YPGGAFDPLGFAKDSSKSGELKLKEIKNGRLAMVAFLGFVAQHAATGKGPIAALGEHLAN
Sbjct: 153 YPGGAFDPLGFAKDSSKSGELKLKEIKNGRLAMVAFLGFVAQHAATGKGPIAALGEHLAN 212

Query: 701 PWGANFATNGISVPFF 748
           PWGANFATNGISVPFF
Sbjct: 213 PWGANFATNGISVPFF 228

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 43/73 (58%), Positives = 44/73 (59%)
 Frame = +3

Query: 60  MALSMRTLSARTAAPRGFSGRRVAAVSNGQPRDHEGRQLAARLGRPRAGCPMTCRATTAS 239
           MALSMRTLSARTAAPRGFSGRRVAAVSNG     +          P A  P         
Sbjct: 1   MALSMRTLSARTAAPRGFSGRRVAAVSNGSRVTMKAGNWLPGSDAP-AWLPDDLPGNYGF 59

Query: 240 TPWSLGKEPASLK 278
            P SLGKEPASLK
Sbjct: 60  DPLSLGKEPASLK 72

>gb|AAD03733.1| light harvesting complex I protein precursor [Chlamydomonas
           reinhardtii]
          Length = 228

 Score =  272 bits (695), Expect = 9e-72
 Identities = 145/196 (73%), Positives = 150/196 (75%), Gaps = 7/196 (3%)
 Frame = +2

Query: 182 PARTPPCWLPDDLPGNYGFDPLVSGQGACFPEAASPRARSSTVAGPCWALPAPWLWSCWA 361
           P    P WLPDDLPGNYGFDPL  G+      A+  R   S V    WA+    L    +
Sbjct: 41  PGSDAPAWLPDDLPGNYGFDPLSLGK----EPASLKRFTESEVIHGRWAM----LGLAGS 92

Query: 362 TATGTM-------PPCGPVNGGKATWFGIEVPFDLNALLAFEFVAMAAAEGQRGDAGGVV 520
            A   +        P   VNGGKATWFGIEVPFDLNALLAFEFVAMAAAEGQRGDAGGVV
Sbjct: 93  LAVELLGYGNWYDAPLWAVNGGKATWFGIEVPFDLNALLAFEFVAMAAAEGQRGDAGGVV 152

Query: 521 YPGGAFDPLGFAKDSSKSGELKLKEIKNGRLAMVAFLGFVAQHAATGKGPIAALGEHLAN 700
           YPGGAFDPLGFAKDSSKSGELKLKEIKNGRLAMVAFLGFVAQHAATGKGPIAALGEHLAN
Sbjct: 153 YPGGAFDPLGFAKDSSKSGELKLKEIKNGRLAMVAFLGFVAQHAATGKGPIAALGEHLAN 212

Query: 701 PWGANFATNGISVPFF 748
           PWGANFATNGISVPFF
Sbjct: 213 PWGANFATNGISVPFF 228

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 43/73 (58%), Positives = 44/73 (59%)
 Frame = +3

Query: 60  MALSMRTLSARTAAPRGFSGRRVAAVSNGQPRDHEGRQLAARLGRPRAGCPMTCRATTAS 239
           MALSMRTLSARTAAPRGFSGRRVAAVSNG     +          P A  P         
Sbjct: 1   MALSMRTLSARTAAPRGFSGRRVAAVSNGSRVTMKAGNWLPGSDAP-AWLPDDLPGNYGF 59

Query: 240 TPWSLGKEPASLK 278
            P SLGKEPASLK
Sbjct: 60  DPLSLGKEPASLK 72

>pir||S31845 chlorophyll a/b-binding protein I-20 precursor - Chlamydomonas
           reinhardtii gi|18125|emb|CAA46235.1| light harvesting
           complex protein I-20 [Chlamydomonas reinhardtii]
          Length = 224

 Score =  272 bits (695), Expect = 9e-72
 Identities = 145/196 (73%), Positives = 150/196 (75%), Gaps = 7/196 (3%)
 Frame = +2

Query: 182 PARTPPCWLPDDLPGNYGFDPLVSGQGACFPEAASPRARSSTVAGPCWALPAPWLWSCWA 361
           P    P WLPDDLPGNYGFDPL  G+      A+  R   S V    WA+    L    +
Sbjct: 37  PGSDAPAWLPDDLPGNYGFDPLSLGK----EPASLKRFTESEVIHGRWAM----LGVAGS 88

Query: 362 TATGTM-------PPCGPVNGGKATWFGIEVPFDLNALLAFEFVAMAAAEGQRGDAGGVV 520
            A   +        P   VNGGKATWFGIEVPFDLNALLAFEFVAMAAAEGQRGDAGGVV
Sbjct: 89  LAVELLGYGNWYDAPLWAVNGGKATWFGIEVPFDLNALLAFEFVAMAAAEGQRGDAGGVV 148

Query: 521 YPGGAFDPLGFAKDSSKSGELKLKEIKNGRLAMVAFLGFVAQHAATGKGPIAALGEHLAN 700
           YPGGAFDPLGFAKDSSKSGELKLKEIKNGRLAMVAFLGFVAQHAATGKGPIAALGEHLAN
Sbjct: 149 YPGGAFDPLGFAKDSSKSGELKLKEIKNGRLAMVAFLGFVAQHAATGKGPIAALGEHLAN 208

Query: 701 PWGANFATNGISVPFF 748
           PWGANFATNGISVPFF
Sbjct: 209 PWGANFATNGISVPFF 224

 Score = 60.8 bits (146), Expect = 4e-08
 Identities = 39/69 (56%), Positives = 40/69 (57%)
 Frame = +3

Query: 72  MRTLSARTAAPRGFSGRRVAAVSNGQPRDHEGRQLAARLGRPRAGCPMTCRATTASTPWS 251
           MRTLSARTAAPRGFSGRRVAAVSNG     +          P A  P          P S
Sbjct: 1   MRTLSARTAAPRGFSGRRVAAVSNGSRVTMKAGNWLPGSDAP-AWLPDDLPGNYGFDPLS 59

Query: 252 LGKEPASLK 278
           LGKEPASLK
Sbjct: 60  LGKEPASLK 68

>gb|AAG28464.1|AF195794_1 chlorophyll A-B binding protein of LHCI; CAB6A; light-harvesting
           complex I protein [Chlamydomonas reinhardtii]
          Length = 239

 Score =  218 bits (555), Expect = 2e-55
 Identities = 121/182 (66%), Positives = 127/182 (69%), Gaps = 7/182 (3%)
 Frame = +2

Query: 182 PARTPPCWLPDDLPGNYGFDPLVSGQGACFPEAASPRARSSTVAGPCWALPAPWLWSCWA 361
           P    P WLPDDLPGNYGFDPL  G+      A+  R   S V    WA+    L    +
Sbjct: 41  PGSDAPAWLPDDLPGNYGFDPLSLGK----EPASLKRFTESEVIHGRWAM----LGVAGS 92

Query: 362 TATGTM-------PPCGPVNGGKATWFGIEVPFDLNALLAFEFVAMAAAEGQRGDAGGVV 520
            A   +        P   VNGGKATWFGIEVPFDLNALLAFEFVAMAAAEGQR       
Sbjct: 93  LAVELLGYGNWYDAPLWAVNGGKATWFGIEVPFDLNALLAFEFVAMAAAEGQRRRCRRRR 152

Query: 521 YPGGAFDPLGFAKDSSKSGELKLKEIKNGRLAMVAFLGFVAQHAATGKGPIAALGEHLAN 700
            PGGAFDPLGFAKDSSKSGELKLKEIKNGRLAMVAFLGFVAQHAATGK P+AALGEHLAN
Sbjct: 153 LPGGAFDPLGFAKDSSKSGELKLKEIKNGRLAMVAFLGFVAQHAATGKAPLAALGEHLAN 212

Query: 701 PW 706
           PW
Sbjct: 213 PW 214

 Score = 67.4 bits (163), Expect = 5e-10
 Identities = 43/73 (58%), Positives = 44/73 (59%)
 Frame = +3

Query: 60  MALSMRTLSARTAAPRGFSGRRVAAVSNGQPRDHEGRQLAARLGRPRAGCPMTCRATTAS 239
           MALSMRTLSARTAAPRGFSGRRVAAVSNG     +          P A  P         
Sbjct: 1   MALSMRTLSARTAAPRGFSGRRVAAVSNGSRVTMKAGNWLPGSDAP-AWLPDDLPGNYGF 59

Query: 240 TPWSLGKEPASLK 278
            P SLGKEPASLK
Sbjct: 60  DPLSLGKEPASLK 72

 Score = 58.5 bits (140), Expect = 2e-07
 Identities = 28/40 (70%), Positives = 29/40 (72%)
 Frame = +3

Query: 663 RAPLLPWASTWPTLGAPTLPPTASPSPSSKCTLPDTSCVD 782
           +APL           APTLPPTASPSPSSKCTLPDTSCVD
Sbjct: 200 KAPLAALGEHLANPWAPTLPPTASPSPSSKCTLPDTSCVD 239

>pir||PQ0764 chlorophyll a/b-binding protein type Ib, 21K chain precursor -
           barley (fragment) gi|544700|gb|AAB29485.1|
           light-harvesting complex I; LHC I [Hordeum vulgare]
          Length = 221

 Score =  109 bits (272), Expect(2) = 5e-36
 Identities = 63/109 (57%), Positives = 76/109 (68%), Gaps = 5/109 (4%)
 Frame = +2

Query: 404 GKATWFGIEVPF-DLNALLAFEFVAMAAAEGQRG---DAGGVVYPGGAFDPLGFAKDSSK 571
           G+AT+ G  VP+ +L  +LA EF+A+A AE QR    D     YPGGAFDPLGF+KD +K
Sbjct: 100 GQATYLGNPVPWGNLPTILAIEFLAIAFAEQQRTMEKDPEKKKYPGGAFDPLGFSKDPAK 159

Query: 572 SGELKLKEIKNGRLAMVAFLGF-VAQHAATGKGPIAALGEHLANPWGAN 715
             ELKLKEIKNGRLAM+AF+GF V Q A  G GP+  L  HLA+PW  N
Sbjct: 160 FEELKLKEIKNGRLAMLAFVGFCVQQSAYPGTGPLENLATHLADPWHNN 208

 Score = 65.5 bits (158), Expect(2) = 5e-36
 Identities = 44/87 (50%), Positives = 49/87 (55%), Gaps = 3/87 (3%)
 Frame = +1

Query: 142 TGSRVTMKAGNWLPGSDAPV-LAAR*PAGQLRLRPPGLWARSLLP*S--RFTESEVIHGR 312
           T  RVTM A  W PG   P  LA   P G LR+RP GL   + +P +  RF ESE+ H R
Sbjct: 14  TSGRVTMSA-EWFPGQPRPAHLAGSSPRG-LRVRPLGL---ATVPENFERFKESEIYHCR 68

Query: 313 WAMLGVAGSLAVELLGYGNWYDAPLWA 393
           WAML V G L  E LG GNW  A  WA
Sbjct: 69  WAMLCVPGVLVPEALGLGNWVKAQEWA 95



EST assemble image


clone accession position
1 MX224h06_r BP090502 1 460
2 HC090b06_r AV638737 42 517
3 MX222a02_r BP090314 47 327
4 MXL100g02_r BP098881 49 521
5 LC094c03_r AV625535 105 568
6 MX208c09_r BP089487 106 512
7 CM002a11_r AV397885 111 725
8 HC013g07_r AV632875 114 638
9 CM070d12_r AV391282 114 809
10 CM053e06_r AV389925 117 728
11 MXL049g11_r BP095944 118 560
12 CM057b10_r AV390482 118 766
13 HC001b04_r AV631872 118 682
14 MXL022h09_r BP094430 118 664
15 MXL075d12_r BP097422 118 504
16 HC051h02_r AV635855 118 606
17 MX103c01_r BP088964 119 586
18 HC092h12_r AV638945 119 658
19 MX103g05_r BP089010 119 644
20 MX101g11_r BP088850 119 573
21 LC001d07_r AV618921 120 693
22 CM026a06_r AV387532 120 764
23 HC040c09_r AV634972 121 639
24 LC039a07_r AV621648 122 674
25 LC016e08_r AV620028 122 657
26 HC022g08_r AV633599 123 642
27 MX211d12_r BP089654 124 375
28 MX223d09_r BP090399 124 563
29 LC099f10_r AV625907 124 492
30 HC094c06_r AV639042 124 592
31 HC079g03_r AV637945 124 620
32 MX065a01_r BP088611 124 606
33 HC018f05_r AV633257 124 671
34 HC058a11_r AV636330 124 618
35 CM032h04_r AV388532 124 677
36 MX006a02_r BP086293 124 488
37 HC027g03_r AV633983 124 682
38 MX006d04_r BP086314 124 571
39 MX066e12_r BP088688 124 638
40 CL40b06_r AV395384 124 642
41 MXL011c06_r BP093636 124 612
42 HC098e01_r AV639367 124 600
43 LC057d02_r AV622981 125 688
44 HC047g12_r AV635556 125 647
45 CM100h12_r AV392858 125 652
46 CM051h11_r AV389884 127 735
47 CM092e09_r AV392667 127 625
48 CM021d04_r AV387913 127 736
49 CM041a02_r AV389434 127 741
50 CM052f05_r AV390509 127 706
51 CM028a06_r AV387702 127 757
52 CM016b05_r AV387479 128 673
53 MXL080a03_r BP097705 128 689
54 LC023f02_r AV620551 128 717
55 MXL011h09_r BP093677 128 666
56 LC082a06_r AV624744 128 679
57 MX059b11_r BP088389 128 529
58 HC010h04_r AV632650 128 674
59 MX208f09_r BP089506 128 539
60 MX032e04_r BP087345 128 435
61 HC013g12_r AV632879 128 686
62 HC018e12_r AV633253 128 621
63 MXL052g02_r BP096102 128 576
64 CM074b11_r AV391564 129 697
65 MX034g04_r BP087448 130 582
66 HC076f04_r AV637717 130 634
67 MX067c01_r BP088717 130 655
68 CM040e02_r AV389173 131 740
69 HC080h05_r AV638026 131 614
70 HC089a04_r AV638648 131 599
71 CM024c06_r AV388217 132 773
72 CM019f03_r AV387304 132 589
73 HC021e05_r AV633498 132 632
74 CM075b11_r AV391659 132 681
75 CM035g09_r AV388715 133 743
76 CM057c07_r AV390438 133 805
77 MXL060d12_r BP096543 134 584
78 HC096b03_r AV639189 134 608
79 HC080h09_r AV638028 134 600
80 CM015b12_r AV387422 134 781
81 MXL013b10_r BP093756 134 371
82 MXL079d06_r BP097671 134 566
83 HC034f01_r AV634528 134 705
84 CM057f10_r AV390486 134 756
85 LC036h12_r AV621500 136 669
86 HC032a12_r AV634337 137 683
87 HC036a08_r AV634650 137 692
88 CM097b01_r AV393237 138 689
89 LC011d08_r AV619657 139 742
90 CM100g12_r AV392822 139 509
91 HC093g02_r AV639006 148 690
92 HC043f01_r AV635228 152 474
93 CM022g08_r AV387896 155 814
94 HC073e11_r AV637473 155 639
95 CM023a01_r AV387773 155 832
96 MXL047c01_r BP095774 157 522
97 MX211d07_r BP089650 169 429
98 LC056g10_r AV622938 177 749
99 HC057f05_r AV636296 180 429
100 CL26e04_r AV394577 194 710
101 HC004g03_r AV632164 195 651
102 MXL039g04_r BP095310 545 1028
103 CM039b09_r AV388968 747 1306
104 CM089a12_r AV392250 772 1313
105 CM068f06_r AV391061 776 1388
106 CM087e12_r AV392477 793 1314
107 LC035e06_r AV621399 809 1344
108 MX260c03_r BP092870 851 1308
109 CM025c10_r AV388102 898 1469
110 MX011h03_r BP086574 908 1308




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research