KCC000407A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000407A_C01 KCC000407A_c01
CCGACCTATCGTTCACCCACGGTGCTCAGCGAGCCCGTGTTCGACTTCCCGCCGACCCAA
CAGAACAGAAGGCGTGCTCGATTGAAAGATGTCGAACCAGAGCCAGCCCCCTGCTGCTTG
GAAGGCGGCCAAGCCGTTCGTGAACGGTGGCCTGTCCGGCATGCTGGCGACTTGCATCAT
CCAGCCTATTGACATGGTCAAGGTCCTGCATCCAGCTGGGCGCCAAGGGCAGCCCGCTGG
CTGTCGGCGCTGAGATCGTCCGCAAGGACGGCGTCGGTGCCCTGTACAAGGGCCTGAGCG
CCGGTCTGCTGCGTCAGGCGACCTACACGACCACTCGTCTGGGTATCTTCAACATGATGT
CGGAGGAGCTCAAGGCGCGCAACAACGGCCAGAACCTGCCCCTGTGGCAGAAGGCCGTGG
CCGGCCTATCGGCTGGTGGCATTGGCGCCCTGGTCGGCTCCCCCGCCGATCTGACCCTGA
TCCGCATGCAGGCCGACGCCACCCTGGCCCGTTGAGCAGCGCCGCAACTACAAGGGCGTT
GCTGACGCCTTCATCCGTATCGTGAAGGAGGACGGCGTAGGTGGCCTGTTCCGCGGTGCC
GCCCCCACCGTGGTGCGCGCCATGTCGCTGAACATGGGCATGCTCGCCTCCAACGACCAG
GCCAAGGAGGCCATCGAGGCTGCTGGCTTCCCCAAGGGTGGCACCGTGTCCGTGCTGGGT
GGCGCCACCATTGCCGGTTTCATCGCTTCGGCATTCAGCCTGCCGTTCGACTTCATCAAG
ACTCGCCTGCAGAAGATGACCCCCAACCCCGACGGCACCATGCCGTACAAGGGCCCCATC
GACTGCGCCCTGCAGACGCTCAAGAACGAGGGCCCCCTCAAGTTCTACACTGGCTTCCCG
ACCTACTGCATCCGCATTGCGCCGCACGTCGTGTTCACGCTCGTGTTCATGGACGCGCTG
CCCAAGGTGCAGAAGAACTTCGGCCTGTAAGTGTTATGCTTACATTTCCATGGCACGGAC
TGGCATCCCTGGCGCCTGCATAAACCGAGCTTAGAGGTGTGAGCCAAGAATGCGACATAA
AGTGCGACCGCTGACGGAATGTGCGTTTACCAGCGCTAGAGGCAACTGCTAGCTTATCAG
TGGTGCACTGCTATGCCAGCGCAAGGTCAGGGTAGTGGTACTGGTCGTTTCTTGTTTTGT
CGTGCAGCCGTGAGTGAAACGGAGTGTACGAGGATGTGGGCAAGTGGTGTGTGAGTGTGC
AGTCGTTGTTGTGATGTGGCTTGAGCTGATTGTGAGTCTTTAGGTCGAACGCGTATTTGC
TGAATGGTCTAATGATGCGAAGATGTTGAGCGTGGATGCCAGAGTGGCATTGGAGGCGGG
ACACGGGATACGAGCGCCGTGAGCGCTCATGTGCTACGACACCGGGGACGCACTACAGGC
GTTGCGGCTGCACGGGGGCACTTGAGTCGGCAATGCAAAGTGCTTGCGTTGCCGGCAATG
GGCGATGTGTTGGATCAAAACGTCCGTCCCTAACATCTGCTCGGCTCCCCCATTGACCTT
TACCGTATATGGGTGCGCTGAGCTGTGGAGGATTCCGCTGCGGGGGTGGGATGGGGGTCG
GGCAAGGCTGGGGGCCTGCGGGGGATTGGGTCAGCGGCACAGGTCAGCCAGGGTCACGGC
ACGGTCACTCGTGCCCCGAGCTTGGATGCCAGGCCAagtctttctctgcaatcgtcgccg
acctggaagtaaaaaaaaaaaaaaaaaaactcgagatagttctctctctctctctc


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000407A_C01 KCC000407A_c01
         (1796 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

pir||S65042 2-oxoglutarate/malate translocator (clone OMT103), m...   179  5e-84
pir||S65040 2-oxoglutarate/malate translocator (clones OMT134 an...   177  2e-83
emb|CAC84547.1| dicarboxylate/tricarboxylate carrier [Nicotiana ...   180  7e-82
emb|CAC84545.1| dicarboxylate/tricarboxylate carrier [Nicotiana ...   174  3e-81
emb|CAC12820.1| mitochondrial 2-oxoglutarate/malate carrier prot...   174  1e-80

>pir||S65042 2-oxoglutarate/malate translocator (clone OMT103), mitochondrial
           membrane - proso millet gi|1100743|dbj|BAA08105.1|
           2-oxoglutarate/malate translocator [Panicum miliaceum]
          Length = 302

 Score =  179 bits (455), Expect(3) = 5e-84
 Identities = 86/160 (53%), Positives = 114/160 (70%)
 Frame = +1

Query: 508 PVEQRRNYKGVADAFIRIVKEDGVGGLFRGAAPTVVRAMSLNMGMLASNDQAKEAIEAAG 687
           P  QRRNYK    A  RIV ++GV  L++GA PTVVRAMSLNMGMLAS DQ+ E      
Sbjct: 144 PAAQRRNYKNAFHALYRIVADEGVLALWKGAGPTVVRAMSLNMGMLASYDQSVELFRDT- 202

Query: 688 FPKGGTVSVLGGATIAGFIASAFSLPFDFIKTRLQKMTPNPDGTMPYKGPIDCALQTLKN 867
              G   ++LG + ++GF ASA SLPFD++KT++QKM P+ +G  PY G +DC ++TLK+
Sbjct: 203 LGAGELSTMLGASAVSGFCASACSLPFDYVKTQIQKMQPDANGKYPYTGSLDCVMKTLKS 262

Query: 868 EGPLKFYTGFPTYCIRIAPHVVFTLVFMDALPKVQKNFGL 987
            GP KFYTGFP YC+RIAPHV+ T +F++ + K +K+ GL
Sbjct: 263 GGPFKFYTGFPVYCVRIAPHVMLTWIFLNQIQKFEKDIGL 302

 Score =  115 bits (288), Expect(3) = 5e-84
 Identities = 61/99 (61%), Positives = 75/99 (75%)
 Frame = +3

Query: 210 IQLGAKGSPLAVGAEIVRKDGVGALYKGLSAGLLRQATYTTTRLGIFNMMSEELKARNNG 389
           IQLG +GS   V  +++  +G+G+ YKGLSAGLLRQATYTT RLG F +++ +    N G
Sbjct: 46  IQLG-EGSAATVTKKMLANEGIGSFYKGLSAGLLRQATYTTARLGSFRVLTNKAVEANEG 104

Query: 390 QNLPLWQKAVAGLSAGGIGALVGSPADLTLIRMQADATL 506
           + LPL QKAV GL+AG IGA VGSPADL LIRMQAD+TL
Sbjct: 105 KPLPLLQKAVIGLTAGAIGASVGSPADLALIRMQADSTL 143

 Score = 62.4 bits (150), Expect(3) = 5e-84
 Identities = 29/42 (69%), Positives = 30/42 (71%)
 Frame = +2

Query: 80  D*KMSNQSQPPAAWKAAKPFVNGGLSGMLATCIIQPIDMVKV 205
           D K      P AAW   KPFVNGG SGMLATC+IQPIDMVKV
Sbjct: 3   DAKQQQAVAPSAAWMTVKPFVNGGASGMLATCVIQPIDMVKV 44

>pir||S65040 2-oxoglutarate/malate translocator (clones OMT134 and OMT106),
           mitochondrial membrane - proso millet
           gi|1100739|dbj|BAA08103.1| 2-oxoglutarate/malate
           translocator [Panicum miliaceum]
           gi|1100741|dbj|BAA08104.1| 2-oxoglutarate/malate
           translocator [Panicum miliaceum]
          Length = 302

 Score =  177 bits (450), Expect(3) = 2e-83
 Identities = 85/160 (53%), Positives = 113/160 (70%)
 Frame = +1

Query: 508 PVEQRRNYKGVADAFIRIVKEDGVGGLFRGAAPTVVRAMSLNMGMLASNDQAKEAIEAAG 687
           P  QRRNYK    A  RIV ++GV  L++GA PTVVRAMSLNMGMLAS DQ+ E      
Sbjct: 144 PAAQRRNYKNAFHALYRIVADEGVLALWKGAGPTVVRAMSLNMGMLASYDQSVELFRDK- 202

Query: 688 FPKGGTVSVLGGATIAGFIASAFSLPFDFIKTRLQKMTPNPDGTMPYKGPIDCALQTLKN 867
              G   ++LG + ++GF ASA SLPFD++KT++QKM P+ +G  PY G +DC ++TLK+
Sbjct: 203 LGAGELSTMLGASAVSGFCASACSLPFDYVKTQIQKMQPDANGKYPYTGSLDCVMKTLKS 262

Query: 868 EGPLKFYTGFPTYCIRIAPHVVFTLVFMDALPKVQKNFGL 987
            GP KFYTGFP YC+RI PHV+ T +F++ + K +K+ GL
Sbjct: 263 GGPFKFYTGFPVYCVRIGPHVMLTWIFLNQIQKFEKDMGL 302

 Score =  115 bits (288), Expect(3) = 2e-83
 Identities = 61/99 (61%), Positives = 75/99 (75%)
 Frame = +3

Query: 210 IQLGAKGSPLAVGAEIVRKDGVGALYKGLSAGLLRQATYTTTRLGIFNMMSEELKARNNG 389
           IQLG +GS   V  +++  +G+G+ YKGLSAGLLRQATYTT RLG F +++ +    N G
Sbjct: 46  IQLG-EGSAATVTKKMLANEGIGSFYKGLSAGLLRQATYTTARLGSFRVLTNKAVEANEG 104

Query: 390 QNLPLWQKAVAGLSAGGIGALVGSPADLTLIRMQADATL 506
           + LPL QKAV GL+AG IGA VGSPADL LIRMQAD+TL
Sbjct: 105 KPLPLLQKAVIGLTAGAIGASVGSPADLALIRMQADSTL 143

 Score = 62.0 bits (149), Expect(3) = 2e-83
 Identities = 29/42 (69%), Positives = 30/42 (71%)
 Frame = +2

Query: 80  D*KMSNQSQPPAAWKAAKPFVNGGLSGMLATCIIQPIDMVKV 205
           D K      P AAW   KPFVNGG SGMLATC+IQPIDMVKV
Sbjct: 3   DAKQQQAVAPSAAWMMVKPFVNGGASGMLATCVIQPIDMVKV 44

>emb|CAC84547.1| dicarboxylate/tricarboxylate carrier [Nicotiana tabacum]
          Length = 300

 Score =  180 bits (457), Expect(3) = 7e-82
 Identities = 86/160 (53%), Positives = 115/160 (71%)
 Frame = +1

Query: 508 PVEQRRNYKGVADAFIRIVKEDGVGGLFRGAAPTVVRAMSLNMGMLASNDQAKEAIEAAG 687
           PV QRRNY     A  RIV ++GV  L++GA PTVVRAM+LNMGMLAS DQ+ E  +   
Sbjct: 142 PVAQRRNYTNAFHALYRIVADEGVLSLWKGAGPTVVRAMALNMGMLASYDQSVEFFKD-N 200

Query: 688 FPKGGTVSVLGGATIAGFIASAFSLPFDFIKTRLQKMTPNPDGTMPYKGPIDCALQTLKN 867
              G   +V+G ++++GF A+A SLPFD++KT++QKM P+  G  PY G  DCA++TLK+
Sbjct: 201 LGMGEAATVVGASSVSGFFAAACSLPFDYVKTQIQKMQPDAQGKYPYTGSFDCAMKTLKS 260

Query: 868 EGPLKFYTGFPTYCIRIAPHVVFTLVFMDALPKVQKNFGL 987
            GP KFYTGFP YC+RIAPHV+ T +F++ + KV+K  GL
Sbjct: 261 GGPFKFYTGFPVYCVRIAPHVMMTWIFLNQIQKVEKKIGL 300

 Score =  114 bits (285), Expect(3) = 7e-82
 Identities = 61/99 (61%), Positives = 75/99 (75%)
 Frame = +3

Query: 210 IQLGAKGSPLAVGAEIVRKDGVGALYKGLSAGLLRQATYTTTRLGIFNMMSEELKARNNG 389
           IQLG +GS   V   +++ +G GA YKGLSAGLLRQATYTT RLG F +++ +    N+G
Sbjct: 44  IQLG-QGSAGEVTRTMLKNEGFGAFYKGLSAGLLRQATYTTARLGSFRVLTNKAIEANDG 102

Query: 390 QNLPLWQKAVAGLSAGGIGALVGSPADLTLIRMQADATL 506
           + LPL+QKA+ GL+AG IGA  GSPADL LIRMQADATL
Sbjct: 103 KPLPLYQKALCGLTAGAIGACFGSPADLALIRMQADATL 141

 Score = 55.5 bits (132), Expect(3) = 7e-82
 Identities = 23/30 (76%), Positives = 25/30 (82%)
 Frame = +2

Query: 116 AWKAAKPFVNGGLSGMLATCIIQPIDMVKV 205
           AW   KPF NGG SGMLATC+IQPIDM+KV
Sbjct: 13  AWPTVKPFANGGASGMLATCVIQPIDMIKV 42

>emb|CAC84545.1| dicarboxylate/tricarboxylate carrier [Nicotiana tabacum]
          Length = 297

 Score =  174 bits (442), Expect(3) = 3e-81
 Identities = 84/161 (52%), Positives = 116/161 (71%), Gaps = 1/161 (0%)
 Frame = +1

Query: 508 PVEQRRNYKGVADAFIRIVKEDGVGGLFRGAAPTVVRAMSLNMGMLASNDQAKEAI-EAA 684
           P+ QRR+Y     A  RIV ++GV  L++GA PTVVRAM+LNMGMLAS DQ+ E   +  
Sbjct: 139 PLAQRRHYTNAFHALSRIVADEGVLALWKGAGPTVVRAMALNMGMLASYDQSVEFCRDNL 198

Query: 685 GFPKGGTVSVLGGATIAGFIASAFSLPFDFIKTRLQKMTPNPDGTMPYKGPIDCALQTLK 864
           G  +  TV  +G ++++GF A+A SLPFD++KT++QKM P+ +G +PY G  DCA++TLK
Sbjct: 199 GMSEAATV--VGASSVSGFFAAACSLPFDYVKTQIQKMQPDAEGKLPYSGSFDCAMKTLK 256

Query: 865 NEGPLKFYTGFPTYCIRIAPHVVFTLVFMDALPKVQKNFGL 987
             GP KFYTGFP YC+RIAPHV+ T +F++ + K +K  GL
Sbjct: 257 AGGPFKFYTGFPVYCVRIAPHVMMTWIFLNQIQKAEKKLGL 297

 Score =  116 bits (291), Expect(3) = 3e-81
 Identities = 62/99 (62%), Positives = 75/99 (75%)
 Frame = +3

Query: 210 IQLGAKGSPLAVGAEIVRKDGVGALYKGLSAGLLRQATYTTTRLGIFNMMSEELKARNNG 389
           IQLG +GS + V   +++ +G GA YKGLSAGLLRQATYTT RLG F  ++ +    N G
Sbjct: 41  IQLG-QGSAVDVTKTMLKNEGFGAFYKGLSAGLLRQATYTTARLGSFRSLTNKAIEANEG 99

Query: 390 QNLPLWQKAVAGLSAGGIGALVGSPADLTLIRMQADATL 506
           + LPL+QKA+ GL+AG IGA VGSPADL LIRMQADATL
Sbjct: 100 KPLPLYQKALCGLTAGAIGACVGSPADLALIRMQADATL 138

 Score = 56.6 bits (135), Expect(3) = 3e-81
 Identities = 24/39 (61%), Positives = 28/39 (71%)
 Frame = +2

Query: 89  MSNQSQPPAAWKAAKPFVNGGLSGMLATCIIQPIDMVKV 205
           M  + +    W   KPFVNGG SGMLATC+IQPIDM+KV
Sbjct: 1   MGEKPKSGGVWPTVKPFVNGGASGMLATCVIQPIDMIKV 39

>emb|CAC12820.1| mitochondrial 2-oxoglutarate/malate carrier protein [Nicotiana
           tabacum]
          Length = 297

 Score =  174 bits (442), Expect(3) = 1e-80
 Identities = 84/161 (52%), Positives = 116/161 (71%), Gaps = 1/161 (0%)
 Frame = +1

Query: 508 PVEQRRNYKGVADAFIRIVKEDGVGGLFRGAAPTVVRAMSLNMGMLASNDQAKEAI-EAA 684
           P+ QRR+Y     A  RIV ++GV  L++GA PTVVRAM+LNMGMLAS DQ+ E   +  
Sbjct: 139 PLAQRRHYTNAFHALSRIVADEGVLALWKGAGPTVVRAMALNMGMLASYDQSVEFCRDNL 198

Query: 685 GFPKGGTVSVLGGATIAGFIASAFSLPFDFIKTRLQKMTPNPDGTMPYKGPIDCALQTLK 864
           G  +  TV  +G ++++GF A+A SLPFD++KT++QKM P+ +G +PY G  DCA++TLK
Sbjct: 199 GMSEAATV--VGASSVSGFFAAACSLPFDYVKTQIQKMQPDAEGKLPYSGSFDCAMKTLK 256

Query: 865 NEGPLKFYTGFPTYCIRIAPHVVFTLVFMDALPKVQKNFGL 987
             GP KFYTGFP YC+RIAPHV+ T +F++ + K +K  GL
Sbjct: 257 AGGPFKFYTGFPVYCVRIAPHVMMTWIFLNQIQKAEKKLGL 297

 Score =  115 bits (288), Expect(3) = 1e-80
 Identities = 61/99 (61%), Positives = 75/99 (75%)
 Frame = +3

Query: 210 IQLGAKGSPLAVGAEIVRKDGVGALYKGLSAGLLRQATYTTTRLGIFNMMSEELKARNNG 389
           IQLG +GS + V   +++ +G GA YKGLSAGLLRQATYTT RLG F +++ +    N G
Sbjct: 41  IQLG-QGSAVDVTKTMLKNEGFGAFYKGLSAGLLRQATYTTARLGSFRILTNKAIEANEG 99

Query: 390 QNLPLWQKAVAGLSAGGIGALVGSPADLTLIRMQADATL 506
           + LPL+QKA+ GL+AG IGA  GSPADL LIRMQADATL
Sbjct: 100 KPLPLYQKALCGLTAGAIGACFGSPADLALIRMQADATL 138

 Score = 55.8 bits (133), Expect(3) = 1e-80
 Identities = 24/39 (61%), Positives = 28/39 (71%)
 Frame = +2

Query: 89  MSNQSQPPAAWKAAKPFVNGGLSGMLATCIIQPIDMVKV 205
           M  + +    W   KPFVNGG SGMLATC+IQPIDM+KV
Sbjct: 1   MVEKPKSGGVWPTVKPFVNGGASGMLATCVIQPIDMIKV 39



EST assemble image


clone accession position
1 MX220b05_r BP090183 1 515
2 HC053h07_r AV636003 16 543
3 HC022g01_r AV633593 86 585
4 LC073f12_r AV624156 89 615
5 LC002a04_r AV618968 91 641
6 LC072g10_r AV624089 91 600
7 LC044g08_r AV622103 91 609
8 LC092b06_r AV625409 91 617
9 HC039e04_r AV634906 94 640
10 MX229a03_r BP090777 94 410
11 LC013h01_r AV619835 95 628
12 LC061e08_r AV623284 95 608
13 LC009g12_r AV619547 95 644
14 LC045d06_r AV622037 95 593
15 LC077e01_r AV624415 95 637
16 LC045c02_r AV622257 98 620
17 LC059a07_r AV623108 98 638
18 HC042e03_r AV635145 99 513
19 MX240g08_r BP091547 99 330
20 HC032g11_r AV634394 101 599
21 MX257c12_r BP092656 102 563
22 LC084h01_r AV624941 102 505
23 CM074g06_r AV391561 102 694
24 LC093a12_r AV625469 104 504
25 HC017g05_r AV633183 104 548
26 LC020b12_r AV620295 104 641
27 LC050h08_r AV622532 107 646
28 MXL057c10_r BP096354 109 523
29 LC084c03_r AV624895 109 625
30 HC067c07_r AV637003 109 597
31 MX218f04_r BP090090 109 577
32 CM014e06_r AV387392 110 722
33 CM018a12_r AV387218 110 657
34 CM033f01_r AV388401 112 589
35 CM082b12_r AV392098 114 509
36 LC053g12_r AV622742 115 642
37 HC004d07_r AV632137 117 489
38 HC097b07_r AV639266 118 628
39 HC041d12_r AV635066 118 709
40 MX068d03_r BP088766 118 460
41 MX250h03_r BP092189 119 592
42 HC086g03_r AV638465 119 542
43 MX225f01_r BP090556 119 572
44 MX026b02_r BP087127 124 496
45 LC061f11_r AV623295 126 592
46 LC066c06_r AV623611 127 625
47 MX247a04_r BP091952 153 354
48 HC064g12_r AV636832 156 697
49 HC094h09_r AV639094 178 600
50 CM093h08_r AV392987 200 619
51 HC012h11_r AV632814 217 583
52 HC046d07_r AV635443 222 698
53 CM081c06_r AV391892 244 813
54 LC004f02_r AV619162 265 812
55 HC035c01_r AV634581 266 769
56 HC093f04_r AV639000 267 764
57 MX023b04_r BP087025 290 771
58 HC085g11_r AV638392 295 711
59 LC032g02_r AV621207 307 639
60 LC045g01_r AV622293 325 867
61 HC042f04_r AV635156 333 717
62 CM077b05_r AV391747 341 956
63 HC086a05_r AV638409 376 824
64 HC080e01_r AV638001 390 1004
65 LC015c08_r AV619939 394 918
66 LC019c02_r AV620223 406 915
67 HC083g07_r AV638245 449 992
68 LC084e01_r AV624915 486 1015
69 LC062g03_r AV623368 496 1052
70 HC068e08_r AV637088 504 1017
71 HC095d12_r AV639139 507 928
72 HC021g06_r AV633522 526 1011
73 LCL095e01_r AV631519 539 753
74 CM079a07_r AV391936 605 1095
75 MX104e12_r BP089081 612 1129
76 MX103a03_r BP088946 613 998
77 HC074a02_r AV637508 614 1046
78 MXL097c04_r BP098675 616 1092
79 HC052f11_r AV635921 665 1160
80 MX015f06_r BP086735 707 1095
81 HC078c03_r AV637837 820 1357
82 MXL042h11_r BP095512 982 1373
83 LC001c02_r AV618910 1015 1553
84 MXL023e07_r BP094467 1049 1381
85 CL26d05_r AV394607 1129 1616
86 MX257c03_r BP092647 1134 1690
87 CL52h07_r AV395846 1150 1637
88 LC007a04_r AV619344 1152 1666
89 MXL016g05_r BP093997 1218 1687
90 MX218e03_r BP090081 1239 1656
91 LC035d03_r AV621388 1288 1754
92 MXL034g09_r BP095036 1365 1685
93 LCL098f05_r AV631716 1520 1918




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research