KCC000406A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000406A_C01 KCC000406A_c01
gtaatatccacagcGGCGTGACCATACTCATGGCTGTGCGCGCCAGTCAACCGACTGGCC
TGAAATGGGGCTGCCCGGGAATTAGGCACCTGCCGAGCTAGTTCCAGCCTGCAAGTTGCG
GAAGCTGGACTGGAAGACTCTTCACATGAAAGTACATTACTGTAATGAATGCTTATCAAC
CTGTGAAGACCGACTGGGAGCTTTCGAGGCACTGATGTCTTTTCCGCCTTGAAGGAGCAA
TAGCAGCTGGTTCAGACAACATGGATCAAGCATACAGTGCTGCTCGAACGCCTGGGCGTC
AAACAGAGGATATGGAGTCGGAAGCAGCCAGGAGCAGGTTTCAGCTGCAGTCCGTGCTCG
GCAAGGGCGCTTACGGCACTGTGTATGCTGCCATTGACACGGCCTCGGGGGAGCGTGTGG
CCATCAAGGTGATCCCAGTCACAGAGCAGGACCGCGAGGAGTTCAAACAGATCCAGCGCG
AGGTGGCCTTCCTGGCAGACTGCAAACACCCAAATGTCGTGAGATACCTGGGCAGCTACC
GGCTTTCTGGGGAGCTGTGGATCGTGATGGAGTACTGCGGCGGCGGATCAGTGAGCGACC
TGATGTCGGCGGGGCGGGCGCCGAT


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000406A_C01 KCC000406A_c01
         (625 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

gb|AAF27066.1|AC008262_15 F4N2.17 [Arabidopsis thaliana]              106  3e-22
ref|NP_564955.1| serine/threonine protein kinase, putative [Arab...   106  3e-22
gb|AAG45491.1| 36I5.3 [Oryza sativa (japonica cultivar-group)]        103  3e-21
gb|AAM47579.1| putative serine/ threonine kinase [Sorghum bicolor]    102  6e-21
gb|AAG49001.1| putative serine/threonine kinase [Hordeum vulgare...   101  8e-21

>gb|AAF27066.1|AC008262_15 F4N2.17 [Arabidopsis thaliana]
          Length = 1120

 Score =  106 bits (264), Expect = 3e-22
 Identities = 58/122 (47%), Positives = 79/122 (64%), Gaps = 2/122 (1%)
 Frame = +3

Query: 249 GSDN--MDQAYSAARTPGRQTEDMESEAARSRFQLQSVLGKGAYGTVYAAIDTASGERVA 422
           G DN  M Q  S   T     + +  E   ++++  + LGKG+YG+VY A D  + E VA
Sbjct: 218 GEDNRKMQQQNSKMSTTSLP-DSITREDPTTKYEFLNELGKGSYGSVYKARDLKTSEIVA 276

Query: 423 IKVIPVTEQDREEFKQIQREVAFLADCKHPNVVRYLGSYRLSGELWIVMEYCGGGSVSDL 602
           +KVI +TE + E +++I+ E+  L  C HPNVVRYLGSY+    LWIVMEYCGGGSV+DL
Sbjct: 277 VKVISLTEGE-EGYEEIRGEIEMLQQCNHPNVVRYLGSYQGEDYLWIVMEYCGGGSVADL 335

Query: 603 MS 608
           M+
Sbjct: 336 MN 337

>ref|NP_564955.1| serine/threonine protein kinase, putative [Arabidopsis thaliana]
           gi|25404800|pir||B96716 probable serine/threonine kinase
           F23O10.20 [imported] - Arabidopsis thaliana
           gi|2352084|gb|AAB68776.1| serine/threonine kinase
           [Arabidopsis thaliana]
           gi|12325090|gb|AAG52499.1|AC018364_17 putative
           serine/threonine kinase; 70789-76610 [Arabidopsis
           thaliana]
          Length = 836

 Score =  106 bits (264), Expect = 3e-22
 Identities = 58/122 (47%), Positives = 79/122 (64%), Gaps = 2/122 (1%)
 Frame = +3

Query: 249 GSDN--MDQAYSAARTPGRQTEDMESEAARSRFQLQSVLGKGAYGTVYAAIDTASGERVA 422
           G DN  M Q  S   T     + +  E   ++++  + LGKG+YG+VY A D  + E VA
Sbjct: 218 GEDNRKMQQQNSKMSTTSLP-DSITREDPTTKYEFLNELGKGSYGSVYKARDLKTSEIVA 276

Query: 423 IKVIPVTEQDREEFKQIQREVAFLADCKHPNVVRYLGSYRLSGELWIVMEYCGGGSVSDL 602
           +KVI +TE + E +++I+ E+  L  C HPNVVRYLGSY+    LWIVMEYCGGGSV+DL
Sbjct: 277 VKVISLTEGE-EGYEEIRGEIEMLQQCNHPNVVRYLGSYQGEDYLWIVMEYCGGGSVADL 335

Query: 603 MS 608
           M+
Sbjct: 336 MN 337

>gb|AAG45491.1| 36I5.3 [Oryza sativa (japonica cultivar-group)]
          Length = 842

 Score =  103 bits (256), Expect = 3e-21
 Identities = 52/106 (49%), Positives = 69/106 (65%)
 Frame = +3

Query: 306 EDMESEAARSRFQLQSVLGKGAYGTVYAAIDTASGERVAIKVIPVTEQDREEFKQIQREV 485
           E +  E   ++++L   LGKG+YG VY A D  + E VAIK+I +TE + E ++ I+ E+
Sbjct: 250 ESVTREDPSTKYELLHELGKGSYGAVYKARDLRTQELVAIKIISLTEGE-EGYEDIRGEI 308

Query: 486 AFLADCKHPNVVRYLGSYRLSGELWIVMEYCGGGSVSDLMSAGRAP 623
             L  C HPNVVRY GSY+    LWIVMEYCGGGSV+DL+     P
Sbjct: 309 EMLQQCSHPNVVRYFGSYQGEEYLWIVMEYCGGGSVADLIGITEEP 354

>gb|AAM47579.1| putative serine/ threonine kinase [Sorghum bicolor]
          Length = 855

 Score =  102 bits (253), Expect = 6e-21
 Identities = 50/106 (47%), Positives = 69/106 (64%)
 Frame = +3

Query: 306 EDMESEAARSRFQLQSVLGKGAYGTVYAAIDTASGERVAIKVIPVTEQDREEFKQIQREV 485
           + +  E   ++++L   LGKG+YG VY A D  + E VA+K+I +TE + E ++ I+ E+
Sbjct: 264 DSVTREDPSTKYELLHELGKGSYGAVYKARDLRTQELVAVKIISLTEGE-EGYEDIRGEI 322

Query: 486 AFLADCKHPNVVRYLGSYRLSGELWIVMEYCGGGSVSDLMSAGRAP 623
             L  C HPNVVRY GSY+    LWIVMEYCGGGSV+DL+     P
Sbjct: 323 EMLQQCSHPNVVRYFGSYQGEDYLWIVMEYCGGGSVADLIGITEEP 368

>gb|AAG49001.1| putative serine/threonine kinase [Hordeum vulgare subsp. vulgare]
          Length = 825

 Score =  101 bits (252), Expect = 8e-21
 Identities = 50/106 (47%), Positives = 69/106 (64%)
 Frame = +3

Query: 306 EDMESEAARSRFQLQSVLGKGAYGTVYAAIDTASGERVAIKVIPVTEQDREEFKQIQREV 485
           + +  E   ++++L   LGKG+YG VY A D  + E VA+K+I +TE + E ++ I+ E+
Sbjct: 239 DSVTREDPSTKYELLHELGKGSYGAVYKARDLRTQELVAVKIISLTEGE-EGYEDIRGEI 297

Query: 486 AFLADCKHPNVVRYLGSYRLSGELWIVMEYCGGGSVSDLMSAGRAP 623
             L  C HPNVVRY GSY+    LWIVMEYCGGGSV+DL+     P
Sbjct: 298 EMLQQCSHPNVVRYFGSYQGEEYLWIVMEYCGGGSVADLIGITEEP 343



EST assemble image


clone accession position
1 LCL058c07_r AV629410 1 540
2 CL26c10_r AV394622 15 417
3 CL74c07_r AV396486 136 625




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research