KCC000405A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000405A_C01 KCC000405A_c01
CCTTCTCTGCTACTTTGCAGGCCCAATCCACTACAATGGCCCTGTCGATGATCCGCAAGT
CGGCCGCTGCCCCCGTTCGCCGGGCTGCCGCTGCCCCCGTGGTCGTTCGCGGCCGTCGGG
TCATCACCTTCGCCGCCGTGGACAAGGCCAAGGTGCTGGAGGACGTGCGCTCCATCATCT
CCACCCAGCTGGGCACTGAGCTGGAGAAGGTTGCCCCCGAGGCCAAGTTCGTTGACCTGG
GCGCCGACTCCCTGGACACGGTCGAGATCATGATGGCTCTGGAGGAGAAGTTCGAGATTG
CCCTGGAGGAGGAGGGTGCCGAGAAGATCGCCACCGTCCAGGACGCCGCGGACATGATCG
CCGCCCAGATCGCCGCCAAGGGCAACTAAACTAACTGTCTCCATTCTATCCTGACCATCT
GACTGAGAAGACGCTTCATGTATACTGTGTTCAACCGTGTGTGTCAGGCTAGGCGCATCC
CGTGGCGGTGGAGAAGATAATGAGCGAATGCTGGGGCTGGGTGTGGTGAAGAGTGCTGCC
GGAGGCGAATGCCCCCAGTGCGATGCACTGGAGCTTGGCACGCCCTGTGCAATAGGGCCT
CAGGCGGGGCAGCTGCCCGGTGCGGCTGCCTACTATACATAAAAACAGGCGTCACGCGGC
GCCGCAAGTGCGAGTTTAGGGCCTGCAGTTCACGGTTTTTGATGCTGTGCCGTGTTGCAG
GCGCGCCTTGCGCGCCGAG


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000405A_C01 KCC000405A_c01
         (739 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

gb|AAQ73137.1| putative acyl carrier protein 2 [Chlamydomonas re...   216  4e-55
sp|P93092|ACP1_CASGL Acyl carrier protein 1, chloroplast precurs...    84  2e-15
ref|NP_187153.1| acyl carrier protein 1 (ACP), chloroplast [Arab...    81  1e-14
sp|P32887|ACP3_BRANA Acyl carrier protein, chloroplast precursor...    80  3e-14
sp|P08971|ACP5_BRANA Acyl carrier protein, chloroplast precursor...    80  3e-14

>gb|AAQ73137.1| putative acyl carrier protein 2 [Chlamydomonas reinhardtii]
          Length = 117

 Score =  216 bits (549), Expect = 4e-55
 Identities = 117/117 (100%), Positives = 117/117 (100%)
 Frame = +3

Query: 36  MALSMIRKSAAAPVRRAAAAPVVVRGRRVITFAAVDKAKVLEDVRSIISTQLGTELEKVA 215
           MALSMIRKSAAAPVRRAAAAPVVVRGRRVITFAAVDKAKVLEDVRSIISTQLGTELEKVA
Sbjct: 1   MALSMIRKSAAAPVRRAAAAPVVVRGRRVITFAAVDKAKVLEDVRSIISTQLGTELEKVA 60

Query: 216 PEAKFVDLGADSLDTVEIMMALEEKFEIALEEEGAEKIATVQDAADMIAAQIAAKGN 386
           PEAKFVDLGADSLDTVEIMMALEEKFEIALEEEGAEKIATVQDAADMIAAQIAAKGN
Sbjct: 61  PEAKFVDLGADSLDTVEIMMALEEKFEIALEEEGAEKIATVQDAADMIAAQIAAKGN 117

>sp|P93092|ACP1_CASGL Acyl carrier protein 1, chloroplast precursor (ACP 1)
           gi|7442268|pir||T09583 acyl carrier protein - swamp oak
           gi|1838961|emb|CAA71885.1| acyl carrier protein
           [Casuarina glauca]
          Length = 136

 Score = 84.3 bits (207), Expect = 2e-15
 Identities = 54/125 (43%), Positives = 76/125 (60%), Gaps = 1/125 (0%)
 Frame = +3

Query: 9   ATLQAQSTTMALSMIRKSAAAPVRRAAAAPVVVRGRRVITFAAVDKAKVLEDVRSIISTQ 188
           A+ +A      +S +R S + P++  + AP+ +R  R +   A  K + +E V +I+  Q
Sbjct: 12  ASFKASLAPSRVSNLR-SVSLPIKGKSFAPLRMRSARFVVCCAA-KPETVEKVCAIVKKQ 69

Query: 189 LGTELEK-VAPEAKFVDLGADSLDTVEIMMALEEKFEIALEEEGAEKIATVQDAADMIAA 365
           L    +  V  E+KF  LGADSLDTVEI+M LEE+F I +EEE A+ IATVQDAAD+I  
Sbjct: 70  LALPDDSAVTGESKFATLGADSLDTVEIVMGLEEEFGINVEEESAQSIATVQDAADLIEK 129

Query: 366 QIAAK 380
            I  K
Sbjct: 130 LIEKK 134

>ref|NP_187153.1| acyl carrier protein 1 (ACP), chloroplast [Arabidopsis thaliana]
           gi|113171|sp|P11829|ACP1_ARATH Acyl carrier protein 1,
           chloroplast precursor (ACP) gi|81596|pir||S03267 acyl
           carrier protein precursor - Arabidopsis thaliana
           gi|16152|emb|CAA31991.1| acyl carrier protein
           [Arabidopsis thaliana]
           gi|12322844|gb|AAG51406.1|AC009465_6 acyl carrier
           protein 1 precursor (ACP); 12067-13082 [Arabidopsis
           thaliana] gi|21553427|gb|AAM62520.1| acyl carrier
           protein 1 precursor ACP [Arabidopsis thaliana]
           gi|30102574|gb|AAP21205.1| At3g05020 [Arabidopsis
           thaliana]
          Length = 137

 Score = 81.3 bits (199), Expect = 1e-14
 Identities = 53/132 (40%), Positives = 75/132 (56%), Gaps = 6/132 (4%)
 Frame = +3

Query: 3   FSATLQAQSTTMALSMIRKSAAAPVRRAAAAPVVVRGRRVI-----TFAAVDKAKVLEDV 167
           FSA++  Q++ +A + I     A +       +    RR I     + +   K + +E V
Sbjct: 5   FSASVSLQTSCLATTRISFQKPALISNHGKTNLSFNLRRSIPSRRLSVSCAAKQETIEKV 64

Query: 168 RSIISTQLG-TELEKVAPEAKFVDLGADSLDTVEIMMALEEKFEIALEEEGAEKIATVQD 344
            +I+  QL  T  +KV  E KF DLGADSLDTVEI+M LEE+F I + EE A+KIATV+ 
Sbjct: 65  SAIVKKQLSLTPDKKVVAETKFADLGADSLDTVEIVMGLEEEFNIQMAEEKAQKIATVEQ 124

Query: 345 AADMIAAQIAAK 380
           AA++I   I  K
Sbjct: 125 AAELIEELINEK 136

>sp|P32887|ACP3_BRANA Acyl carrier protein, chloroplast precursor (ACP) (Clones 34C02 and
           10C04) gi|17769|emb|CAA31516.1| unnamed protein product
           [Brassica napus]
          Length = 134

 Score = 80.5 bits (197), Expect = 3e-14
 Identities = 49/132 (37%), Positives = 75/132 (56%), Gaps = 12/132 (9%)
 Frame = +3

Query: 21  AQSTTMALSMIRKSAAAPVRRAAAAPVVVRGRRV-----------ITFAAVDKAKVLEDV 167
           A + + ++S +  S A P R +   P +V    +           ++ +   K + +E V
Sbjct: 2   ATTFSASVSTLATSLATPTRISFQKPALVSRTNLSFNLRRSIPTRLSVSCAAKPETIEKV 61

Query: 168 RSIISTQLGT-ELEKVAPEAKFVDLGADSLDTVEIMMALEEKFEIALEEEGAEKIATVQD 344
             I+  QL   + +KV  E KF DLGADSLDTVEI+M LEE+F+I + EE A+KIATV++
Sbjct: 62  SKIVKKQLSLKDDQKVVAETKFADLGADSLDTVEIVMGLEEEFDIEMAEEKAQKIATVEE 121

Query: 345 AADMIAAQIAAK 380
           AA++I   +  K
Sbjct: 122 AAELIEELVLLK 133

>sp|P08971|ACP5_BRANA Acyl carrier protein, chloroplast precursor (ACP) (Clones 28F10,
           10H11/11D11, 34F12 and 04F05/05E01) gi|81677|pir||S00806
           acyl carrier protein precursor (clone 28F10) - rape
           gi|17759|emb|CAA31513.1| unnamed protein product
           [Brassica napus] gi|17763|emb|CAA30782.1| unnamed
           protein product [Brassica napus]
          Length = 134

 Score = 80.5 bits (197), Expect = 3e-14
 Identities = 58/132 (43%), Positives = 81/132 (60%), Gaps = 6/132 (4%)
 Frame = +3

Query: 3   FSATLQAQSTTMALSMIRKSAAAPVR-----RAAAAPVVVRGRRVITFAAVDKAKVLEDV 167
           FSA++  Q+T++A +  R S   PV      R   +  + R R  I+ AA  K + +E V
Sbjct: 5   FSASVSMQATSLATTT-RISFQKPVLVSNHGRTNLSFNLSRTRLSISCAA--KQETVEKV 61

Query: 168 RSIISTQLGT-ELEKVAPEAKFVDLGADSLDTVEIMMALEEKFEIALEEEGAEKIATVQD 344
             I+  QL   + ++V  E KFVDLGADSLDTVEI+M LEE+F I + EE A+KIATV+ 
Sbjct: 62  SEIVKKQLSLKDDQQVVAETKFVDLGADSLDTVEIVMGLEEEFGIQMAEEKAQKIATVEQ 121

Query: 345 AADMIAAQIAAK 380
           AA++I   + AK
Sbjct: 122 AAELIEELMQAK 133



EST assemble image


clone accession position
1 HC060g10_r AV636541 1 565
2 HC095b02_r AV639109 6 506
3 MXL075d01_r BP097415 36 490
4 MXL025e09_r BP094604 98 460
5 MX030c10_r BP087277 101 471
6 HC036h09_r AV634717 101 588
7 HC086h09_r AV638481 102 590
8 HC068c08_r AV637071 103 626
9 MX015d08_r BP086726 103 500
10 MX048b12_r BP087968 106 458
11 HC029g05_r AV634140 107 593
12 MX031a04_r BP087295 107 557
13 HC068a09_r AV637053 107 623
14 MXL084a02_r BP097947 108 599
15 HC008f01_r AV632466 108 638
16 HC019b07_r AV633300 111 630
17 HC079e11_r AV637933 111 622
18 HC016b03_r AV633053 113 352
19 CM046e08_r AV388043 124 680
20 MXL065c07_r BP096811 134 624
21 CL26f09_r AV394618 154 431
22 HCL099a12_r AV645167 233 632
23 CL26c09_r AV394613 375 853




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research