KCC000404A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000404A_C01 KCC000404A_c01
ATGTAACACACACACAGCACACGAACAAATCTCGCTTTGCGGTTGCCCTTGCTCACTGCA
GCTGCTTCTAGCTCCGGGGCCTCCCCCCCGCGCTTCGTTTTCGCTGTTCCGACCCCTACA
GACATTCAGAATCAATAGCACTACTACTTTTGGGCACTATCGGGCCAGCGCGCTCCCACT
TTGGGCTGAGTTCCGTCGCTGACCAATTTGTTGAGGCAGCAGCCTGCACGATCGCCCTGG
CCCCGTTTTGACGGCGATTATTAGTTATCAGGAGCAATGGCTCACACAAGGGTGCTTCTG
GCCTGAGGCCTTCGGCGCAGACTCGGACTCAGTAATTTCGCCAAGGCCAACCATGTCCGC
GAGCCCTGATGATGGCGCCAGCTTTCGCCTGAAGAGGTCCCTCACGCTAGACCCCTCTGG
ACTCACGGCTACTGAGAGTGGACTTCAGCTGCTGCAAGTGTGCTGTTCCTGCCCCCAGAC
GGCCGGTGACAAGCAGTCGACAGAACCTTGCGTATCGTGCGCGACTGCTCGCAGCGCGTC
TCCGCCCCCGACGCCCTTCGTGGCCCCATCAGCGGTTAACCAGGACGTTGTTTCGGCGTT
TGAGGCGGCACACAAGCTGGCGGTGGCTCCAGGCGATTCTGTTTTCAGGAACCAGGACAC
AATCATCGAGACGAGCAGCTCAGAGGACGCGTGCGCGAGCTCTCAAACGCCTGCAGCTCA
GCGCATCAGTGGCACGCTCAGCACGCCGGCGCACGCAGGCGCCCTGGCGGTTGCTGCTGG
AAATGGCGATGTTAATATTGTTGGCCGTGAGGCCAACCTCCAGCGCCAGTCTTCTGCATG
CCTTGGCGCCACTGGCAGCTGCCCGGCGCACGGTGTCAAGGCTGTGTGCGGGAAGCGGAA
CAAAATGGAGGATATGTACGCAGTCCAGCCCAACTTCTTCG


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000404A_C01 KCC000404A_c01
         (941 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

pir||T44768 antifreeze glycopeptide AFGP polyprotein precursor [...    40  0.044
gb|AAF34780.1| srpA [Streptococcus cristatus]                          40  0.057
pir||T18535 high molecular mass nuclear antigen - chicken (fragm...    40  0.057
ref|NP_180499.1| protein phosphatase 2C (PP2C), putative [Arabid...    40  0.074
gb|AAL13053.1| platelet binding protein GspB [Streptococcus gord...    39  0.13

>pir||T44768 antifreeze glycopeptide AFGP polyprotein precursor [imported] -
           Boreogadus saida gi|2078483|gb|AAC60129.1| antifreeze
           glycopeptide AFGP polyprotein precursor
          Length = 507

 Score = 40.4 bits (93), Expect = 0.044
 Identities = 32/137 (23%), Positives = 49/137 (35%)
 Frame = +2

Query: 473 PQTAGDKQSTEPCVSCATARSASPPPTPFVAPSAVNQDVVSAFEAAHKLAVAPGDSVFRN 652
           P TA    +     + AT  +A+ P T   A +       +A  A    A          
Sbjct: 49  PATAATAATEATAATAATPATAATPATAATAATTAATAATAATAATPARAARAATPATAA 108

Query: 653 QDTIIETSSSEDACASSQTPAAQRISGTLSTPAHAGALAVAAGNGDVNIVGREANLQRQS 832
                 T+++    A+++TPA      T +TPA A   A AA           A   R +
Sbjct: 109 TPATAATAATAATAATAETPARAATPATAATPATAATPATAATAATAATSATAATAARAA 168

Query: 833 SACLGATGSCPAHGVKA 883
           +    AT + PA   +A
Sbjct: 169 TPATAATPATPATAARA 185

 Score = 36.6 bits (83), Expect = 0.63
 Identities = 42/194 (21%), Positives = 64/194 (32%)
 Frame = +2

Query: 302 PEAFGADSDSVISPRPTMSASPDDGASFRLKRSLTLDPSGLTATESGLQLLQVCCSCPQT 481
           P      +    + R   +A+P   A+     +     +  TA  +         + P T
Sbjct: 170 PATAATPATPATAARAARAATPATAATAATAATAATAATAATAATAATPARAARAATPAT 229

Query: 482 AGDKQSTEPCVSCATARSASPPPTPFVAPSAVNQDVVSAFEAAHKLAVAPGDSVFRNQDT 661
           A    +     + ATA +A    TP  A  A      +    A   A  P        D 
Sbjct: 230 APTPATAATPATAATAATAPTAATPARAARAATPATAATLATAATPAT-PATPATAATDA 288

Query: 662 IIETSSSEDACASSQTPAAQRISGTLSTPAHAGALAVAAGNGDVNIVGREANLQRQSSAC 841
              T+++    A+  TPA    + T +TPA A   A AA         R A     ++A 
Sbjct: 289 TAATAATPARAATPATPAT---AATPATPATAATAATAATAATAATPARAARAATPATAA 345

Query: 842 LGATGSCPAHGVKA 883
             AT +  A    A
Sbjct: 346 TPATAATAATAATA 359

 Score = 35.4 bits (80), Expect = 1.4
 Identities = 40/180 (22%), Positives = 59/180 (32%)
 Frame = +2

Query: 344 RPTMSASPDDGASFRLKRSLTLDPSGLTATESGLQLLQVCCSCPQTAGDKQSTEPCVSCA 523
           R    A+P   A+     +     +  TA  +         + P TA    +     + A
Sbjct: 298 RAATPATPATAATPATPATAATAATAATAATAATPARAARAATPATAATPATAATAATAA 357

Query: 524 TARSASPPPTPFVAPSAVNQDVVSAFEAAHKLAVAPGDSVFRNQDTIIETSSSEDACASS 703
           TA +A+   TP  A  A      +    A   A A              T+++    A +
Sbjct: 358 TAATAATAATPARAARAATPATAATAATAATAATAA-------------TAATPARAARA 404

Query: 704 QTPAAQRISGTLSTPAHAGALAVAAGNGDVNIVGREANLQRQSSACLGATGSCPAHGVKA 883
            TPA      T +TPA A   A AA           A     ++A   AT   PA   +A
Sbjct: 405 ATPATPATPATPATPATAATAATAA---------TAATAATAATAATAATAPTPARAARA 455

>gb|AAF34780.1| srpA [Streptococcus cristatus]
          Length = 3381

 Score = 40.0 bits (92), Expect = 0.057
 Identities = 44/196 (22%), Positives = 82/196 (41%), Gaps = 8/196 (4%)
 Frame = +2

Query: 305  EAFGADSDSVISPRPTMSASPDDGASFRLKRSLTLDPSGLTATESGLQLLQVCCSCPQTA 484
            ++  A   S  S   ++SAS    AS  + +S +   + ++A++S    + V  S   + 
Sbjct: 835  QSTSASVSSSQSASASVSASQSASASVSVSQSAS---ASVSASQSASASVSVSQSASASV 891

Query: 485  GDKQSTEPCVSCATARSASPPPTPFVAPSAVNQDVVSAF-----EAAHKLAVAPGDSVFR 649
               QST   VS + + SAS   +   + S  +    SA       A+  ++ +   SV  
Sbjct: 892  SASQSTSASVSASQSASASVSASQSASASVSSSHSASASVSVSQSASASVSASHSASVSA 951

Query: 650  NQDTIIETSSSEDACASSQTPAAQRISGTLSTPAHAGALAVAAGNGDVNI---VGREANL 820
            +Q   +  S+S+ A  S     ++ IS + S  A   A   A+ +  V+         + 
Sbjct: 952  SQSASVSVSASQSASTSVSASHSESISASQSASASISASISASQSASVSASQSASASVSA 1011

Query: 821  QRQSSACLGATGSCPA 868
             + +SA + A+ S  A
Sbjct: 1012 SQSTSASVSASQSASA 1027

 Score = 37.7 bits (86), Expect = 0.28
 Identities = 43/176 (24%), Positives = 72/176 (40%), Gaps = 3/176 (1%)
 Frame = +2

Query: 350  TMSASPDDGASFRLKRSLTLDPSGLTATESGLQLLQVCCSCPQTAG--DKQSTEPCVSCA 523
            ++S S    AS    +S +   + ++A+ S  Q   V  S   +A     QST   VS +
Sbjct: 1944 SISVSASHSASISASQSTS---ASISASISASQSASVSASQSASASVSASQSTSASVSAS 2000

Query: 524  TARSASPPPTPFVAPSAVNQDVVS-AFEAAHKLAVAPGDSVFRNQDTIIETSSSEDACAS 700
             + SAS         ++ NQ+  S +  A+H  +++   S   +    I  S S    AS
Sbjct: 2001 QSVSAS---------ASNNQNSASISVSASHSASISASQSTSASISASISASQSASVSAS 2051

Query: 701  SQTPAAQRISGTLSTPAHAGALAVAAGNGDVNIVGREANLQRQSSACLGATGSCPA 868
                A+   S + S    A   A A+ + + N     A++    SA + A+ S  A
Sbjct: 2052 QSASASVSASQSTSASVSASQSASASASNNQNSASISASISASQSASVSASQSASA 2107

 Score = 37.7 bits (86), Expect = 0.28
 Identities = 43/176 (24%), Positives = 72/176 (40%), Gaps = 3/176 (1%)
 Frame = +2

Query: 350  TMSASPDDGASFRLKRSLTLDPSGLTATESGLQLLQVCCSCPQTAG--DKQSTEPCVSCA 523
            ++S S    AS    +S +   + ++A+ S  Q   V  S   +A     QST   VS +
Sbjct: 1392 SISVSASHSASISASQSTS---ASISASISASQSASVSASQSASASVSASQSTSASVSAS 1448

Query: 524  TARSASPPPTPFVAPSAVNQDVVS-AFEAAHKLAVAPGDSVFRNQDTIIETSSSEDACAS 700
             + SAS         ++ NQ+  S +  A+H  +++   S   +    I  S S    AS
Sbjct: 1449 QSVSAS---------ASNNQNSASISVSASHSASISASQSTSASISASISASQSASVSAS 1499

Query: 701  SQTPAAQRISGTLSTPAHAGALAVAAGNGDVNIVGREANLQRQSSACLGATGSCPA 868
                A+   S + S    A   A A+ + + N     A++    SA + A+ S  A
Sbjct: 1500 QSASASVSASQSTSASVSASQSASASASNNQNSASISASISASQSASVSASQSASA 1555

 Score = 36.6 bits (83), Expect = 0.63
 Identities = 44/181 (24%), Positives = 75/181 (41%), Gaps = 3/181 (1%)
 Frame = +2

Query: 335  ISPRPTMSASPDDGASFRLKRSLTLDPSGLTATESGLQLLQVCCSCPQTAG--DKQSTEP 508
            +S   + SAS     S     S   + + ++A+ S  Q   V  S   +A     QST  
Sbjct: 2058 VSASQSTSASVSASQSASASASNNQNSASISASISASQSASVSASQSASASVSASQSTSA 2117

Query: 509  CVSCATARSASPPPTPFVAPSAVNQDVVS-AFEAAHKLAVAPGDSVFRNQDTIIETSSSE 685
             VS + + SAS         ++ NQ+  S +  A+H  +++   S   +    I  S+S+
Sbjct: 2118 SVSASQSVSAS---------ASNNQNSASISVSASHSASISASQSTSASISASI--SASQ 2166

Query: 686  DACASSQTPAAQRISGTLSTPAHAGALAVAAGNGDVNIVGREANLQRQSSACLGATGSCP 865
             A  S+   A+  +S + ST A   A   A+ +   N      ++    SA + A+ S  
Sbjct: 2167 SASVSASQSASASVSASQSTSASVSASQSASASASNNQNSASISVSASQSASISASQSAS 2226

Query: 866  A 868
            A
Sbjct: 2227 A 2227

 Score = 36.6 bits (83), Expect = 0.63
 Identities = 44/181 (24%), Positives = 75/181 (41%), Gaps = 3/181 (1%)
 Frame = +2

Query: 335  ISPRPTMSASPDDGASFRLKRSLTLDPSGLTATESGLQLLQVCCSCPQTAG--DKQSTEP 508
            +S   + SAS     S     S   + + ++A+ S  Q   V  S   +A     QST  
Sbjct: 1506 VSASQSTSASVSASQSASASASNNQNSASISASISASQSASVSASQSASASVSASQSTSA 1565

Query: 509  CVSCATARSASPPPTPFVAPSAVNQDVVS-AFEAAHKLAVAPGDSVFRNQDTIIETSSSE 685
             VS + + SAS         ++ NQ+  S +  A+H  +++   S   +    I  S+S+
Sbjct: 1566 SVSASQSVSAS---------ASNNQNSASISVSASHSASISASQSTSASISASI--SASQ 1614

Query: 686  DACASSQTPAAQRISGTLSTPAHAGALAVAAGNGDVNIVGREANLQRQSSACLGATGSCP 865
             A  S+   A+  +S + ST A   A   A+ +   N      ++    SA + A+ S  
Sbjct: 1615 SASVSASQSASASVSASQSTSASVSASQSASASASNNQNSASISVSASQSASISASQSAS 1674

Query: 866  A 868
            A
Sbjct: 1675 A 1675

 Score = 36.2 bits (82), Expect = 0.82
 Identities = 43/176 (24%), Positives = 75/176 (42%), Gaps = 3/176 (1%)
 Frame = +2

Query: 350  TMSASPDDGASFRLKRSLTLDPSGLTATESGLQLLQVCCSCPQTAG--DKQSTEPCVSCA 523
            ++S S    AS    +S +   + ++A+ S  Q   V  S   +A     QST   VS +
Sbjct: 2208 SISVSASQSASISASQSAS---ASISASISASQSASVSASQSASASVSASQSTSASVSAS 2264

Query: 524  TARSASPPPTPFVAPSAVNQDVVS-AFEAAHKLAVAPGDSVFRNQDTIIETSSSEDACAS 700
             + SAS         ++ NQ+  S +  A+H  +++   S   +    I  S+S+ A  S
Sbjct: 2265 QSASAS---------ASNNQNSASISVSASHSASISASQSASASISASI--SASQSASVS 2313

Query: 701  SQTPAAQRISGTLSTPAHAGALAVAAGNGDVNIVGREANLQRQSSACLGATGSCPA 868
            +   A+  +S + ST A   A   A+ +   N      ++    SA + A+ S  A
Sbjct: 2314 ASQSASASVSASQSTSASVSASQSASASASNNQNSASISVSASQSASISASQSASA 2369

 Score = 36.2 bits (82), Expect = 0.82
 Identities = 43/176 (24%), Positives = 75/176 (42%), Gaps = 3/176 (1%)
 Frame = +2

Query: 350  TMSASPDDGASFRLKRSLTLDPSGLTATESGLQLLQVCCSCPQTAG--DKQSTEPCVSCA 523
            ++S S    AS    +S +   + ++A+ S  Q   V  S   +A     QST   VS +
Sbjct: 1656 SISVSASQSASISASQSAS---ASISASISASQSASVSASQSASASVSASQSTSASVSAS 1712

Query: 524  TARSASPPPTPFVAPSAVNQDVVS-AFEAAHKLAVAPGDSVFRNQDTIIETSSSEDACAS 700
             + SAS         ++ NQ+  S +  A+H  +++   S   +    I  S+S+ A  S
Sbjct: 1713 QSASAS---------ASNNQNSASISVSASHSASISASQSASASISASI--SASQSASVS 1761

Query: 701  SQTPAAQRISGTLSTPAHAGALAVAAGNGDVNIVGREANLQRQSSACLGATGSCPA 868
            +   A+  +S + ST A   A   A+ +   N      ++    SA + A+ S  A
Sbjct: 1762 ASQSASASVSASQSTSASVSASQSASASASNNQNSASISVSASQSASISASQSASA 1817

 Score = 35.4 bits (80), Expect = 1.4
 Identities = 42/175 (24%), Positives = 73/175 (41%), Gaps = 2/175 (1%)
 Frame = +2

Query: 350  TMSASPDDGASFRLKRSLTLDPSGLTATESGLQLLQVCCSCPQTAG--DKQSTEPCVSCA 523
            ++S S    AS    +S +   + ++A+ S  Q   V  S   +A     QST   VS +
Sbjct: 1100 SISVSASQSASISASQSAS---ASISASISASQSASVSASQSASASVSASQSTSASVSAS 1156

Query: 524  TARSASPPPTPFVAPSAVNQDVVSAFEAAHKLAVAPGDSVFRNQDTIIETSSSEDACASS 703
             + SAS       A  +V+    ++  A+   +     SV  +Q   +  S+S+ A  S+
Sbjct: 1157 QSASASASNNQNSASISVSASQSASISASQSTSA----SVSASQSASV--SASQSASVSA 1210

Query: 704  QTPAAQRISGTLSTPAHAGALAVAAGNGDVNIVGREANLQRQSSACLGATGSCPA 868
               A+  +S + ST A   A   A+ +   N      ++    SA + A+ S  A
Sbjct: 1211 SQSASASVSASQSTSASVSASQSASASASNNQNSASISVSASQSASISASQSASA 1265

 Score = 35.0 bits (79), Expect = 1.8
 Identities = 42/177 (23%), Positives = 72/177 (39%), Gaps = 7/177 (3%)
 Frame = +2

Query: 350  TMSASPDDGASFRLKRSLTLDPSGLTATESGLQLLQVCCSCPQTAG--DKQSTEPCVSCA 523
            + SAS    AS     S++   S   +  +      +  S  Q+A     QST   VS +
Sbjct: 1136 SQSASASVSASQSTSASVSASQSASASASNNQNSASISVSASQSASISASQSTSASVSAS 1195

Query: 524  TARSASPPPTPFVAPSAVNQDVVSAFE---AAHKLAVAPGDSVFRNQDTI-IETSSSEDA 691
             + S S   +  V+ S      VSA +   A+   + +   S   NQ++  I  S+S+ A
Sbjct: 1196 QSASVSASQSASVSASQSASASVSASQSTSASVSASQSASASASNNQNSASISVSASQSA 1255

Query: 692  CASSQTPAAQRISGTLSTPAHAGALAVAAGNGDVNI-VGREANLQRQSSACLGATGS 859
              S+   A+  IS ++S    A   A  + +  V+      A++    SA   A+ +
Sbjct: 1256 SISASQSASASISASISASQSASVSASQSASASVSASQSTSASVSASQSASASASNN 1312

 Score = 34.7 bits (78), Expect = 2.4
 Identities = 42/175 (24%), Positives = 73/175 (41%), Gaps = 2/175 (1%)
 Frame = +2

Query: 350  TMSASPDDGASFRLKRSLTLDPSGLTATESGLQLLQVCCSCPQTAG--DKQSTEPCVSCA 523
            ++S S    AS    +S +   + ++A+ S  Q   V  S   +A     QST   VS +
Sbjct: 1798 SISVSASQSASISASQSAS---ASISASISASQSASVSASQSASASVSASQSTSASVSAS 1854

Query: 524  TARSASPPPTPFVAPSAVNQDVVSAFEAAHKLAVAPGDSVFRNQDTIIETSSSEDACASS 703
             + SAS       A  +V+    ++  A+   +     SV  +Q   +  S+S+ A  S+
Sbjct: 1855 QSASASASNNQNSASISVSASQSASISASQSTSA----SVSASQSASV--SASQSASVSA 1908

Query: 704  QTPAAQRISGTLSTPAHAGALAVAAGNGDVNIVGREANLQRQSSACLGATGSCPA 868
               A+  +S + ST A   A   A+ +   N      ++    SA + A+ S  A
Sbjct: 1909 SQSASASVSASQSTSASVSASQSASASASNNQNSASISVSASHSASISASQSTSA 1963

 Score = 34.7 bits (78), Expect = 2.4
 Identities = 42/175 (24%), Positives = 73/175 (41%), Gaps = 2/175 (1%)
 Frame = +2

Query: 350  TMSASPDDGASFRLKRSLTLDPSGLTATESGLQLLQVCCSCPQTAG--DKQSTEPCVSCA 523
            ++S S    AS    +S +   + ++A+ S  Q   V  S   +A     QST   VS +
Sbjct: 1246 SISVSASQSASISASQSAS---ASISASISASQSASVSASQSASASVSASQSTSASVSAS 1302

Query: 524  TARSASPPPTPFVAPSAVNQDVVSAFEAAHKLAVAPGDSVFRNQDTIIETSSSEDACASS 703
             + SAS       A  +V+    ++  A+   +     SV  +Q   +  S+S+ A  S+
Sbjct: 1303 QSASASASNNQNSASISVSASQSASISASQSTSA----SVSASQSASV--SASQSASVSA 1356

Query: 704  QTPAAQRISGTLSTPAHAGALAVAAGNGDVNIVGREANLQRQSSACLGATGSCPA 868
               A+  +S + ST A   A   A+ +   N      ++    SA + A+ S  A
Sbjct: 1357 SQSASASVSASQSTSASVSASQSASASASNNQNSASISVSASHSASISASQSTSA 1411

 Score = 34.7 bits (78), Expect = 2.4
 Identities = 40/175 (22%), Positives = 71/175 (39%), Gaps = 2/175 (1%)
 Frame = +2

Query: 350  TMSASPDDGASFRLKRSLTLDPSGLTATESGLQLLQVCCSCPQTAG--DKQSTEPCVSCA 523
            ++S S    AS    +S +   + ++A+ S  Q   V  S   +A     QST   VS +
Sbjct: 2350 SISVSASQSASISASQSAS---ASISASISASQSASVSASQSASASVSASQSTSASVSAS 2406

Query: 524  TARSASPPPTPFVAPSAVNQDVVSAFEAAHKLAVAPGDSVFRNQDTIIETSSSEDACASS 703
             + SAS       A  +V+    ++  A+   + +   S+          S+S+ A  S+
Sbjct: 2407 QSASASASNNQNSASISVSASQSASISASQSASASISASI----------SASQSASVSA 2456

Query: 704  QTPAAQRISGTLSTPAHAGALAVAAGNGDVNIVGREANLQRQSSACLGATGSCPA 868
               A+  +S + ST A   A   A+ +   N      ++    SA + A+ S  A
Sbjct: 2457 SQSASASVSASQSTSASVSASQSASASASNNQNSASISVSASQSASISASQSASA 2511

 Score = 34.3 bits (77), Expect = 3.1
 Identities = 40/175 (22%), Positives = 71/175 (39%), Gaps = 2/175 (1%)
 Frame = +2

Query: 350  TMSASPDDGASFRLKRSLTLDPSGLTATESGLQLLQVCCSCPQTAG--DKQSTEPCVSCA 523
            ++S S    AS    +S +   + ++A+ S  Q   V  S   +A     QST   VS +
Sbjct: 2279 SISVSASHSASISASQSAS---ASISASISASQSASVSASQSASASVSASQSTSASVSAS 2335

Query: 524  TARSASPPPTPFVAPSAVNQDVVSAFEAAHKLAVAPGDSVFRNQDTIIETSSSEDACASS 703
             + SAS       A  +V+    ++  A+   + +   S+          S+S+ A  S+
Sbjct: 2336 QSASASASNNQNSASISVSASQSASISASQSASASISASI----------SASQSASVSA 2385

Query: 704  QTPAAQRISGTLSTPAHAGALAVAAGNGDVNIVGREANLQRQSSACLGATGSCPA 868
               A+  +S + ST A   A   A+ +   N      ++    SA + A+ S  A
Sbjct: 2386 SQSASASVSASQSTSASVSASQSASASASNNQNSASISVSASQSASISASQSASA 2440

 Score = 34.3 bits (77), Expect = 3.1
 Identities = 41/177 (23%), Positives = 71/177 (39%)
 Frame = +2

Query: 338  SPRPTMSASPDDGASFRLKRSLTLDPSGLTATESGLQLLQVCCSCPQTAGDKQSTEPCVS 517
            S   ++SAS    AS    +S ++  S  +A+ S  Q      S   +    QST   VS
Sbjct: 1177 SQSASISASQSTSASVSASQSASVSASQ-SASVSASQ------SASASVSASQSTSASVS 1229

Query: 518  CATARSASPPPTPFVAPSAVNQDVVSAFEAAHKLAVAPGDSVFRNQDTIIETSSSEDACA 697
             + + SAS       A  +V+    ++  A+   + +   S+          S+S+ A  
Sbjct: 1230 ASQSASASASNNQNSASISVSASQSASISASQSASASISASI----------SASQSASV 1279

Query: 698  SSQTPAAQRISGTLSTPAHAGALAVAAGNGDVNIVGREANLQRQSSACLGATGSCPA 868
            S+   A+  +S + ST A   A   A+ +   N      ++    SA + A+ S  A
Sbjct: 1280 SASQSASASVSASQSTSASVSASQSASASASNNQNSASISVSASQSASISASQSTSA 1336

 Score = 33.9 bits (76), Expect = 4.1
 Identities = 40/175 (22%), Positives = 71/175 (39%), Gaps = 2/175 (1%)
 Frame = +2

Query: 350  TMSASPDDGASFRLKRSLTLDPSGLTATESGLQLLQVCCSCPQTAG--DKQSTEPCVSCA 523
            ++S S    AS    +S +   + ++A+ S  Q   V  S   +A     QST   VS +
Sbjct: 1727 SISVSASHSASISASQSAS---ASISASISASQSASVSASQSASASVSASQSTSASVSAS 1783

Query: 524  TARSASPPPTPFVAPSAVNQDVVSAFEAAHKLAVAPGDSVFRNQDTIIETSSSEDACASS 703
             + SAS       A  +V+    ++  A+   + +   S+          S+S+ A  S+
Sbjct: 1784 QSASASASNNQNSASISVSASQSASISASQSASASISASI----------SASQSASVSA 1833

Query: 704  QTPAAQRISGTLSTPAHAGALAVAAGNGDVNIVGREANLQRQSSACLGATGSCPA 868
               A+  +S + ST A   A   A+ +   N      ++    SA + A+ S  A
Sbjct: 1834 SQSASASVSASQSTSASVSASQSASASASNNQNSASISVSASQSASISASQSTSA 1888

 Score = 33.9 bits (76), Expect = 4.1
 Identities = 40/175 (22%), Positives = 71/175 (39%), Gaps = 2/175 (1%)
 Frame = +2

Query: 350  TMSASPDDGASFRLKRSLTLDPSGLTATESGLQLLQVCCSCPQTAG--DKQSTEPCVSCA 523
            ++S S    AS    +S +   + ++A+ S  Q   V  S   +A     QST   VS +
Sbjct: 1585 SISVSASHSASISASQSTS---ASISASISASQSASVSASQSASASVSASQSTSASVSAS 1641

Query: 524  TARSASPPPTPFVAPSAVNQDVVSAFEAAHKLAVAPGDSVFRNQDTIIETSSSEDACASS 703
             + SAS       A  +V+    ++  A+   + +   S+          S+S+ A  S+
Sbjct: 1642 QSASASASNNQNSASISVSASQSASISASQSASASISASI----------SASQSASVSA 1691

Query: 704  QTPAAQRISGTLSTPAHAGALAVAAGNGDVNIVGREANLQRQSSACLGATGSCPA 868
               A+  +S + ST A   A   A+ +   N      ++    SA + A+ S  A
Sbjct: 1692 SQSASASVSASQSTSASVSASQSASASASNNQNSASISVSASHSASISASQSASA 1746

 Score = 33.9 bits (76), Expect = 4.1
 Identities = 43/178 (24%), Positives = 74/178 (41%), Gaps = 1/178 (0%)
 Frame = +2

Query: 338  SPRPTMSASPDDGASFRLKRSLTLDPSGLTATESGLQLLQVCCSCPQTAGDKQSTEPCVS 517
            S   ++SAS    AS    +S ++  S  +A+ S  Q      S   +    QST   VS
Sbjct: 1875 SQSASISASQSTSASVSASQSASVSASQ-SASVSASQ------SASASVSASQSTSASVS 1927

Query: 518  CATARSASPPPTPFVAPSAVNQDVVS-AFEAAHKLAVAPGDSVFRNQDTIIETSSSEDAC 694
             + + SAS         ++ NQ+  S +  A+H  +++   S   +    I  S+S+ A 
Sbjct: 1928 ASQSASAS---------ASNNQNSASISVSASHSASISASQSTSASISASI--SASQSAS 1976

Query: 695  ASSQTPAAQRISGTLSTPAHAGALAVAAGNGDVNIVGREANLQRQSSACLGATGSCPA 868
             S+   A+  +S + ST A   A    + +   N      ++    SA + A+ S  A
Sbjct: 1977 VSASQSASASVSASQSTSASVSASQSVSASASNNQNSASISVSASHSASISASQSTSA 2034

 Score = 33.9 bits (76), Expect = 4.1
 Identities = 43/178 (24%), Positives = 74/178 (41%), Gaps = 1/178 (0%)
 Frame = +2

Query: 338  SPRPTMSASPDDGASFRLKRSLTLDPSGLTATESGLQLLQVCCSCPQTAGDKQSTEPCVS 517
            S   ++SAS    AS    +S ++  S  +A+ S  Q      S   +    QST   VS
Sbjct: 1323 SQSASISASQSTSASVSASQSASVSASQ-SASVSASQ------SASASVSASQSTSASVS 1375

Query: 518  CATARSASPPPTPFVAPSAVNQDVVS-AFEAAHKLAVAPGDSVFRNQDTIIETSSSEDAC 694
             + + SAS         ++ NQ+  S +  A+H  +++   S   +    I  S+S+ A 
Sbjct: 1376 ASQSASAS---------ASNNQNSASISVSASHSASISASQSTSASISASI--SASQSAS 1424

Query: 695  ASSQTPAAQRISGTLSTPAHAGALAVAAGNGDVNIVGREANLQRQSSACLGATGSCPA 868
             S+   A+  +S + ST A   A    + +   N      ++    SA + A+ S  A
Sbjct: 1425 VSASQSASASVSASQSTSASVSASQSVSASASNNQNSASISVSASHSASISASQSTSA 1482

 Score = 33.9 bits (76), Expect = 4.1
 Identities = 40/175 (22%), Positives = 71/175 (39%), Gaps = 2/175 (1%)
 Frame = +2

Query: 350  TMSASPDDGASFRLKRSLTLDPSGLTATESGLQLLQVCCSCPQTAG--DKQSTEPCVSCA 523
            ++S S    AS    +S +   + ++A+ S  Q   V  S   +A     QST   VS +
Sbjct: 2137 SISVSASHSASISASQSTS---ASISASISASQSASVSASQSASASVSASQSTSASVSAS 2193

Query: 524  TARSASPPPTPFVAPSAVNQDVVSAFEAAHKLAVAPGDSVFRNQDTIIETSSSEDACASS 703
             + SAS       A  +V+    ++  A+   + +   S+          S+S+ A  S+
Sbjct: 2194 QSASASASNNQNSASISVSASQSASISASQSASASISASI----------SASQSASVSA 2243

Query: 704  QTPAAQRISGTLSTPAHAGALAVAAGNGDVNIVGREANLQRQSSACLGATGSCPA 868
               A+  +S + ST A   A   A+ +   N      ++    SA + A+ S  A
Sbjct: 2244 SQSASASVSASQSTSASVSASQSASASASNNQNSASISVSASHSASISASQSASA 2298

 Score = 33.5 bits (75), Expect = 5.3
 Identities = 39/172 (22%), Positives = 67/172 (38%), Gaps = 2/172 (1%)
 Frame = +2

Query: 350  TMSASPDDGASFRLKRSLTLDPSGLTATESGLQLLQVCCSCPQTAGDKQSTEPCVSCATA 529
            + SAS    AS     S++   S   +  +      +  S   +A    S     S + +
Sbjct: 1002 SQSASASVSASQSTSASVSASQSASASASNNQNSASISVSASHSASISASQSASASISAS 1061

Query: 530  RSASPPPTPFVAPSAVNQDVVSAFEAAHKLAVAPGDSVFRNQDTI-IETSSSEDACASSQ 706
             SAS   +  V+ S      VSA ++A         S   NQ++  I  S+S+ A  S+ 
Sbjct: 1062 ISASQSASASVSASQSTSASVSASQSA-------SASASNNQNSASISVSASQSASISAS 1114

Query: 707  TPAAQRISGTLSTPAHAGALAVAAGNGDVNI-VGREANLQRQSSACLGATGS 859
              A+  IS ++S    A   A  + +  V+      A++    SA   A+ +
Sbjct: 1115 QSASASISASISASQSASVSASQSASASVSASQSTSASVSASQSASASASNN 1166

 Score = 33.5 bits (75), Expect = 5.3
 Identities = 34/155 (21%), Positives = 63/155 (39%), Gaps = 4/155 (2%)
 Frame = +2

Query: 416  SGLTATESGLQLLQVCCSCPQTAGDK----QSTEPCVSCATARSASPPPTPFVAPSAVNQ 583
            + ++A++S    +    S  Q+A       QST   VS + + SAS       A  +V+ 
Sbjct: 1046 ASISASQSASASISASISASQSASASVSASQSTSASVSASQSASASASNNQNSASISVSA 1105

Query: 584  DVVSAFEAAHKLAVAPGDSVFRNQDTIIETSSSEDACASSQTPAAQRISGTLSTPAHAGA 763
               ++  A+   + +   S+          S+S+ A  S+   A+  +S + ST A   A
Sbjct: 1106 SQSASISASQSASASISASI----------SASQSASVSASQSASASVSASQSTSASVSA 1155

Query: 764  LAVAAGNGDVNIVGREANLQRQSSACLGATGSCPA 868
               A+ +   N      ++    SA + A+ S  A
Sbjct: 1156 SQSASASASNNQNSASISVSASQSASISASQSTSA 1190

>pir||T18535 high molecular mass nuclear antigen - chicken (fragment)
            gi|2754696|dbj|BAA24137.1| high molecular mass nuclear
            antigen [Gallus gallus]
          Length = 1151

 Score = 40.0 bits (92), Expect = 0.057
 Identities = 44/151 (29%), Positives = 55/151 (36%), Gaps = 7/151 (4%)
 Frame = +2

Query: 347  PTMSASPDDGASFRLKRSLTLDPSGLTATESGLQLLQVCCSCPQTAGDKQSTEPCVSCAT 526
            P M+AS           +    P G T T+S         + P  AG      P     T
Sbjct: 870  PPMAASTPQSTPMGAATTTQSPPMGATTTQSPPMGASTPQAPPTVAGSPTPPPPIPPSPT 929

Query: 527  AR------SASPPPTPFVAPSAVNQDVVSAFEAAHKLAVAPG-DSVFRNQDTIIETSSSE 685
            A+      S SPPP P  APSA  Q       AAH    +PG  +V      + E S S 
Sbjct: 930  AQTSPQPMSKSPPPDPPKAPSAAAQ----TSPAAHVANASPGVTAVSPAPIGVTEASPSA 985

Query: 686  DACASSQTPAAQRISGTLSTPAHAGALAVAA 778
            D    S  P A    G  ++PA    +  AA
Sbjct: 986  DGARLSPGPTA-ATDGPKASPAATADVTEAA 1015

>ref|NP_180499.1| protein phosphatase 2C (PP2C), putative [Arabidopsis thaliana]
           gi|25352214|pir||F84695 probable protein phosphatase 2C
           [imported] - Arabidopsis thaliana
           gi|3980397|gb|AAC95200.1| putative protein phosphatase
           2C [Arabidopsis thaliana]
          Length = 362

 Score = 39.7 bits (91), Expect = 0.074
 Identities = 28/90 (31%), Positives = 39/90 (43%), Gaps = 6/90 (6%)
 Frame = +2

Query: 686 DACASS---QTPAAQRISGTLSTPAHAGALAVAAGNGDVNIVGREANLQRQSSACLGATG 856
           DAC SS    TPA  R      T  H         +    +  R +++ R S        
Sbjct: 11  DACPSSVYESTPAHSRRRPRFQTVMHEDWEKNCKRSKQEALATRYSSIPRSSREDFSDQN 70

Query: 857 ---SCPAHGVKAVCGKRNKMEDMYAVQPNF 937
              S P +GV +VCG+R +MED  A+ P+F
Sbjct: 71  VDVSSPRYGVSSVCGRRREMEDAVAIHPSF 100

>gb|AAL13053.1| platelet binding protein GspB [Streptococcus gordonii]
          Length = 3072

 Score = 38.9 bits (89), Expect = 0.13
 Identities = 48/182 (26%), Positives = 74/182 (40%), Gaps = 1/182 (0%)
 Frame = +2

Query: 317  ADSDSVISPRPTMSASPDDGASFRLKRSLTLDPSGLTATESGLQL-LQVCCSCPQTAGDK 493
            A + + +S   + S S    AS     S +   S   +T + +        S   +A + 
Sbjct: 685  ASTSASVSASTSASTSASVSASTSASTSASTSASKSASTSASVSASTSASTSASVSASES 744

Query: 494  QSTEPCVSCATARSASPPPTPFVAPSAVNQDVVSAFEAAHKLAVAPGDSVFRNQDTIIET 673
             ST   VS +T  SAS   +   + SA     VSA E+A         S   +  T   T
Sbjct: 745  ASTSASVSAST--SASTSASVSASTSASTSASVSASESA-------STSASVSASTSAST 795

Query: 674  SSSEDACASSQTPAAQRISGTLSTPAHAGALAVAAGNGDVNIVGREANLQRQSSACLGAT 853
            S+S  A  S+ T A+   S + ST A   A A A+ +  V+     A+    +SA + A+
Sbjct: 796  SASVSASESASTSASVSASTSASTSASVSASASASTSASVS-----ASTSASTSASVSAS 850

Query: 854  GS 859
             S
Sbjct: 851  AS 852

 Score = 38.1 bits (87), Expect = 0.22
 Identities = 44/182 (24%), Positives = 72/182 (39%), Gaps = 1/182 (0%)
 Frame = +2

Query: 317  ADSDSVISPRPTMSASPDDGASFRLKRSLTLDPSGLTATESGLQLLQVCCSCPQTAGDKQ 496
            A + + +S   + S S    AS     S ++  S   +T + +       S   +    +
Sbjct: 877  ASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSA-STSASTSASVSASE 935

Query: 497  STEPCVSCATARSASPPPTPFVAPSAVNQDVVSAFEAAHKLA-VAPGDSVFRNQDTIIET 673
            S     S + + SAS   +   + SA     VSA E+A   A V+   S   +      T
Sbjct: 936  SASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASTSASTSASVSAST 995

Query: 674  SSSEDACASSQTPAAQRISGTLSTPAHAGALAVAAGNGDVNIVGREANLQRQSSACLGAT 853
            S+S  A  S+ T A+   S + ST A   A +V+A           A+    +SA + A+
Sbjct: 996  SASTSASVSASTSASTSASVSASTSASTSA-SVSASESASTSASVSASESASTSASVSAS 1054

Query: 854  GS 859
             S
Sbjct: 1055 TS 1056

 Score = 37.7 bits (86), Expect = 0.28
 Identities = 49/192 (25%), Positives = 77/192 (39%), Gaps = 11/192 (5%)
 Frame = +2

Query: 317  ADSDSVISPRPTMSASPDDGASFRLKRSLTLDPSGLTATESGLQLLQ-VCCSCPQTAGDK 493
            A + + +S   + S S    AS     S ++  S   +T + +   +    S   +A   
Sbjct: 697  ASTSASVSASTSASTSASTSASKSASTSASVSASTSASTSASVSASESASTSASVSASTS 756

Query: 494  QSTEPCVSCATA----------RSASPPPTPFVAPSAVNQDVVSAFEAAHKLAVAPGDSV 643
             ST   VS +T+           SAS   +   + SA     VSA E+A         S 
Sbjct: 757  ASTSASVSASTSASTSASVSASESASTSASVSASTSASTSASVSASESA-------STSA 809

Query: 644  FRNQDTIIETSSSEDACASSQTPAAQRISGTLSTPAHAGALAVAAGNGDVNIVGREANLQ 823
              +  T   TS+S  A AS+ T A+   S + ST A   A A A+ +  V+     A+  
Sbjct: 810  SVSASTSASTSASVSASASASTSASVSASTSASTSASVSASASASTSASVS-----ASTS 864

Query: 824  RQSSACLGATGS 859
              +SA + A+ S
Sbjct: 865  ASTSASVSASES 876

 Score = 37.7 bits (86), Expect = 0.28
 Identities = 46/182 (25%), Positives = 75/182 (40%), Gaps = 1/182 (0%)
 Frame = +2

Query: 317  ADSDSVISPRPTMSASPDDGASFRLKRSLTLDPSGLTATESGLQLLQVCCSCPQTAGDKQ 496
            A + + +S   + S S  + AS     S ++  S   +T + +           +A +  
Sbjct: 1333 ASTSASVSASESASTSASESASESASTSASVSASESASTSASV-----------SASESA 1381

Query: 497  STEPCVSCATARSASPPPTPFVAPSAVNQDVVSAFEAAHKLA-VAPGDSVFRNQDTIIET 673
            ST   VS +T  SAS   +   + SA     VSA E+A   A V+  +S   +      T
Sbjct: 1382 STSASVSAST--SASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSAST 1439

Query: 674  SSSEDACASSQTPAAQRISGTLSTPAHAGALAVAAGNGDVNIVGREANLQRQSSACLGAT 853
            S+S  A  S+   A+   S + ST A   A +V+A           A+    +SA + A+
Sbjct: 1440 SASTSASVSASESASTSTSVSTSTSASTSA-SVSASESASTSASVSASESASTSASVSAS 1498

Query: 854  GS 859
             S
Sbjct: 1499 TS 1500

 Score = 37.4 bits (85), Expect = 0.37
 Identities = 42/184 (22%), Positives = 74/184 (39%), Gaps = 3/184 (1%)
 Frame = +2

Query: 317  ADSDSVISPRPTMSASPDDGASFRLKRSLTLDPSGLTATESGLQLLQVCCSCPQTAGDKQ 496
            A + + +S   ++S S    AS     S ++  S  +A+ S  +      S   +    +
Sbjct: 1189 ASTSASVSASESVSTSASVSASESASTSASVSASE-SASTSASESASESASTSASVSASE 1247

Query: 497  STEPCVSCATARSASPPPTPFVAPSAVNQDVVSAFEAAHKLAVAPGDSVFRNQDTIIETS 676
            S     S + + SAS   +   + SA     VSA E+A   + +   S   +  T    S
Sbjct: 1248 SASTSASVSASESASTSASVSASTSASTSASVSASESA---STSASVSASESASTSASVS 1304

Query: 677  SSEDACASSQTPAAQRISGTLSTPAHAGA---LAVAAGNGDVNIVGREANLQRQSSACLG 847
            +SE A  S+   A++ +S + S  A   A    +V+A           A+    +SA + 
Sbjct: 1305 ASESASTSASVSASESVSTSASVSASESASTSASVSASESASTSASESASESASTSASVS 1364

Query: 848  ATGS 859
            A+ S
Sbjct: 1365 ASES 1368

 Score = 37.4 bits (85), Expect = 0.37
 Identities = 46/183 (25%), Positives = 75/183 (40%), Gaps = 2/183 (1%)
 Frame = +2

Query: 317  ADSDSVISPRPTMSASPDDGASFRLKRSLTLDPSGLTATESGLQLLQ-VCCSCPQTAGDK 493
            A + + +S   + S S    AS     S ++  S   +T + +   + V  S   +A + 
Sbjct: 1273 ASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASESVSTSASVSASES 1332

Query: 494  QSTEPCVSCATARSASPPPTPFVAPSAVNQDVVSAFEAAHKLA-VAPGDSVFRNQDTIIE 670
             ST   VS +   SAS   +   + SA     VSA E+A   A V+  +S   +      
Sbjct: 1333 ASTSASVSAS--ESASTSASESASESASTSASVSASESASTSASVSASESASTSASVSAS 1390

Query: 671  TSSSEDACASSQTPAAQRISGTLSTPAHAGALAVAAGNGDVNIVGREANLQRQSSACLGA 850
            TS+S  A  S+   A+   S + S  A   A +V+A           A+    +SA + A
Sbjct: 1391 TSASTSASVSASESASTSASVSASESASTSA-SVSASESASTSASVSASTSASTSASVSA 1449

Query: 851  TGS 859
            + S
Sbjct: 1450 SES 1452

 Score = 37.0 bits (84), Expect = 0.48
 Identities = 43/185 (23%), Positives = 77/185 (41%), Gaps = 4/185 (2%)
 Frame = +2

Query: 317  ADSDSVISPRPTMSASPDDGASFRLKRSLTLDPSGLTATESGLQL-LQVCCSCPQTAGDK 493
            A + + +S   + S S    AS     S ++  S   +T + +        S   +A + 
Sbjct: 721  ASTSASVSASTSASTSASVSASESASTSASVSASTSASTSASVSASTSASTSASVSASES 780

Query: 494  QSTEPCVSCATARSASPPPTPFVAPS---AVNQDVVSAFEAAHKLAVAPGDSVFRNQDTI 664
             ST   VS +T+ S S   +   + S   +V+    ++  A+   + +   S   +  T 
Sbjct: 781  ASTSASVSASTSASTSASVSASESASTSASVSASTSASTSASVSASASASTSASVSASTS 840

Query: 665  IETSSSEDACASSQTPAAQRISGTLSTPAHAGALAVAAGNGDVNIVGREANLQRQSSACL 844
              TS+S  A AS+ T A+   S + ST A   A   A+ +  V+     A+    +SA +
Sbjct: 841  ASTSASVSASASASTSASVSASTSASTSASVSASESASTSASVS-----ASESASTSASV 895

Query: 845  GATGS 859
             A+ S
Sbjct: 896  SASES 900

 Score = 36.6 bits (83), Expect = 0.63
 Identities = 44/201 (21%), Positives = 77/201 (37%), Gaps = 1/201 (0%)
 Frame = +2

Query: 317  ADSDSVISPRPTMSASPDDGASFRLKRSLTLDPSGLTATESGLQLLQVCCSCPQTAGDKQ 496
            A + + +S   + S S    AS     S ++  S   +T + +       S   +    +
Sbjct: 2779 ASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSA-STSASTSASVSANE 2837

Query: 497  STEPCVSCATARSASPPPTPFVAPSAVNQDVVSAFEAAHKLA-VAPGDSVFRNQDTIIET 673
            S     S + + SAS   +   + SA     VSA E+A   A V+  +S   +      T
Sbjct: 2838 SASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSAST 2897

Query: 674  SSSEDACASSQTPAAQRISGTLSTPAHAGALAVAAGNGDVNIVGREANLQRQSSACLGAT 853
            S+S  A  S+   A+   S + S  A   A +V+A           A+    +SA + A+
Sbjct: 2898 SASTSASVSASESASTSASASASESASTSA-SVSASESASTSASVSASESASTSASVSAS 2956

Query: 854  GSCPAHGVKAVCGKRNKMEDM 916
             S   +   +V    +  E +
Sbjct: 2957 ESASTNASVSVSESMSVSESL 2977

 Score = 36.2 bits (82), Expect = 0.82
 Identities = 45/185 (24%), Positives = 75/185 (40%), Gaps = 4/185 (2%)
 Frame = +2

Query: 317  ADSDSVISPRPTMSASPDDGASFRLKRSLTLDPSGLTATESGLQLLQ-VCCSCPQTAGDK 493
            A + + +S   + S S    AS     S ++  S   +T + +   +    S   +A + 
Sbjct: 1921 ASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASES 1980

Query: 494  QSTEPCVSCATARSASPPPTPFVAPSAVNQDVVSAFEAAHKLAVAPGDSVFRNQDTIIET 673
             ST   VS +T  SAS   +   + SA     VSA E+A   + +   S   +  T    
Sbjct: 1981 ASTSASVSAST--SASTSASVSASESASTSASVSASESA---STSASVSASESASTSASV 2035

Query: 674  SSSEDACASSQTPAAQRISGTLSTPAHAGA---LAVAAGNGDVNIVGREANLQRQSSACL 844
            S+SE A  S+   A++  S + S  A   A    +V+A           A+    +SA +
Sbjct: 2036 SASESASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASESASTSASV 2095

Query: 845  GATGS 859
             A+ S
Sbjct: 2096 SASKS 2100

 Score = 36.2 bits (82), Expect = 0.82
 Identities = 47/182 (25%), Positives = 75/182 (40%), Gaps = 1/182 (0%)
 Frame = +2

Query: 317  ADSDSVISPRPTMSASPDDGASFRLKRSLTLDPSGLTATESGLQLLQ-VCCSCPQTAGDK 493
            A + + +S   + S S    AS     S ++  S   +T + +   +    S   +A + 
Sbjct: 2407 ASTSASVSASTSASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASES 2466

Query: 494  QSTEPCVSCATARSASPPPTPFVAPSAVNQDVVSAFEAAHKLAVAPGDSVFRNQDTIIET 673
             ST   VS +T  SAS   +   + SA     VSA E+A         S   +  T   T
Sbjct: 2467 ASTSASVSAST--SASTSASVSASESASTSASVSASESA-------STSASVSASTSAST 2517

Query: 674  SSSEDACASSQTPAAQRISGTLSTPAHAGALAVAAGNGDVNIVGREANLQRQSSACLGAT 853
            S+S  A  S+ T A+   S + ST A   A   A+ +  V+     A+    +SA + A+
Sbjct: 2518 SASVSASESASTSASVSASESASTSASVSASESASTSASVS-----ASESASTSASVSAS 2572

Query: 854  GS 859
             S
Sbjct: 2573 ES 2574

 Score = 36.2 bits (82), Expect = 0.82
 Identities = 47/190 (24%), Positives = 79/190 (40%), Gaps = 9/190 (4%)
 Frame = +2

Query: 317  ADSDSVISPRPTMSASPDDGASFRLKRSLTLDPSGLTATESGLQLLQ-VCCSCPQTAGDK 493
            A + + +S   + S S    AS     S ++  S   +T + +   +    S  ++A + 
Sbjct: 1033 ASTSASVSASESASTSASVSASTSASTSASVSASESASTSASVSASESASTSASESASES 1092

Query: 494  QSTEPCVSCATARSASPPPTPFVAPSAVNQDVVSAFEAAHKLA-VAPGDSVFRNQDT--- 661
             ST   VS +   SAS   +   + S+     VSA E++   A V+  +S   +      
Sbjct: 1093 ASTSASVSAS--ESASTSASVSASESSSTSASVSASESSSTSASVSASESASTSASVSAS 1150

Query: 662  -IIETSSSEDACASSQTPAAQRISGTLSTPAHAGALAVAAGNGDVNI---VGREANLQRQ 829
                TS+SE A  S+ T A+   S + ST A   A   A+ +  V+    V   A++   
Sbjct: 1151 ESASTSASESASESASTSASVSASESASTSASVSASESASTSASVSASESVSTSASVSAS 1210

Query: 830  SSACLGATGS 859
             SA   A+ S
Sbjct: 1211 ESASTSASVS 1220

 Score = 36.2 bits (82), Expect = 0.82
 Identities = 44/182 (24%), Positives = 73/182 (39%), Gaps = 1/182 (0%)
 Frame = +2

Query: 317  ADSDSVISPRPTMSASPDDGASFRLKRSLTLDPSGLTATESGLQLLQVCCSCPQTAGDKQ 496
            A + + +S   + S S    AS  +  S ++  S  +A+ S   L     S   +    +
Sbjct: 2119 ASTSASVSASESASTSASVSASESVSTSASVSASD-SASISASVLASESASTSASVSASE 2177

Query: 497  STEPCVSCATARSASPPPTPFVAPSAVNQDVVSAFEAAHKLA-VAPGDSVFRNQDTIIET 673
            S     S + + SAS   +   + SA     VSA E+A   A V+  +S   +      T
Sbjct: 2178 SASTSASVSASESASTSASVSASESASTSSSVSASESASTSASVSASESASTSASVSAST 2237

Query: 674  SSSEDACASSQTPAAQRISGTLSTPAHAGALAVAAGNGDVNIVGREANLQRQSSACLGAT 853
            S+S  A  S+   A+   S + S  A   A +V+A           A+    +SA + A+
Sbjct: 2238 SASTSASVSASESASTSASVSASESASTSA-SVSASESASTSASVSASESASTSASVSAS 2296

Query: 854  GS 859
             S
Sbjct: 2297 ES 2298

 Score = 36.2 bits (82), Expect = 0.82
 Identities = 49/181 (27%), Positives = 75/181 (41%), Gaps = 6/181 (3%)
 Frame = +2

Query: 335  ISPRPTMSASPDDGASFRLKRSLTLDPSG-LTATESGLQLLQVCCS--CPQTAGDKQSTE 505
            IS   ++SAS     S  +  S +   S  ++A+ES      V  S     +A    ST 
Sbjct: 649  ISTSGSVSASESASTSSSVSASESASTSASVSASESASTSASVSASTSASTSASVSASTS 708

Query: 506  PCVSCATA--RSASPPPTPFVAPSAVNQDVVSAFEAAHKLA-VAPGDSVFRNQDTIIETS 676
               S +T+  +SAS   +   + SA     VSA E+A   A V+   S   +      TS
Sbjct: 709  ASTSASTSASKSASTSASVSASTSASTSASVSASESASTSASVSASTSASTSASVSASTS 768

Query: 677  SSEDACASSQTPAAQRISGTLSTPAHAGALAVAAGNGDVNIVGREANLQRQSSACLGATG 856
            +S  A  S+   A+   S + ST A   A +V+A           A+    +SA + A+ 
Sbjct: 769  ASTSASVSASESASTSASVSASTSASTSA-SVSASESASTSASVSASTSASTSASVSASA 827

Query: 857  S 859
            S
Sbjct: 828  S 828

 Score = 36.2 bits (82), Expect = 0.82
 Identities = 44/181 (24%), Positives = 70/181 (38%)
 Frame = +2

Query: 317  ADSDSVISPRPTMSASPDDGASFRLKRSLTLDPSGLTATESGLQLLQVCCSCPQTAGDKQ 496
            A + + +S   + S S    AS     S ++  S   +T + +       S   +    +
Sbjct: 1393 ASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSA-STSASTSASVSASE 1451

Query: 497  STEPCVSCATARSASPPPTPFVAPSAVNQDVVSAFEAAHKLAVAPGDSVFRNQDTIIETS 676
            S     S +T+ SAS   +   + SA     VSA E+A         S   +  T   TS
Sbjct: 1452 SASTSTSVSTSTSASTSASVSASESASTSASVSASESA-------STSASVSASTSASTS 1504

Query: 677  SSEDACASSQTPAAQRISGTLSTPAHAGALAVAAGNGDVNIVGREANLQRQSSACLGATG 856
            +S  A  S+ T A+   S + ST A   A   A+ +  V+     A+     SA   A+ 
Sbjct: 1505 ASVSASESASTSASVSASESASTSASVSASESASTSASVS-ASESASTSASVSASTSAST 1563

Query: 857  S 859
            S
Sbjct: 1564 S 1564

 Score = 36.2 bits (82), Expect = 0.82
 Identities = 42/185 (22%), Positives = 76/185 (40%), Gaps = 4/185 (2%)
 Frame = +2

Query: 317  ADSDSVISPRPTMSASPDDGASFRLKRSLTLDPSGLTATESGLQL-LQVCCSCPQTAGDK 493
            A + + +S   + S S    AS     S ++  S   +T + +        S   +A + 
Sbjct: 745  ASTSASVSASTSASTSASVSASTSASTSASVSASESASTSASVSASTSASTSASVSASES 804

Query: 494  QSTEPCVSCATARSASPPPTPFVAPS---AVNQDVVSAFEAAHKLAVAPGDSVFRNQDTI 664
             ST   VS +T+ S S   +   + S   +V+    ++  A+   + +   S   +  T 
Sbjct: 805  ASTSASVSASTSASTSASVSASASASTSASVSASTSASTSASVSASASASTSASVSASTS 864

Query: 665  IETSSSEDACASSQTPAAQRISGTLSTPAHAGALAVAAGNGDVNIVGREANLQRQSSACL 844
              TS+S  A  S+ T A+   S + ST A   A   A+ +  V+     A+    +SA +
Sbjct: 865  ASTSASVSASESASTSASVSASESASTSASVSASESASTSASVS-----ASESASTSASV 919

Query: 845  GATGS 859
             A+ S
Sbjct: 920  SASTS 924

 Score = 35.8 bits (81), Expect = 1.1
 Identities = 43/181 (23%), Positives = 69/181 (37%)
 Frame = +2

Query: 317  ADSDSVISPRPTMSASPDDGASFRLKRSLTLDPSGLTATESGLQLLQVCCSCPQTAGDKQ 496
            A + + +S   + S S    AS     S ++  S   +T + +       S   +    +
Sbjct: 817  ASTSASVSASASASTSASVSASTSASTSASVSASASASTSASVSA-STSASTSASVSASE 875

Query: 497  STEPCVSCATARSASPPPTPFVAPSAVNQDVVSAFEAAHKLAVAPGDSVFRNQDTIIETS 676
            S     S + + SAS   +   + SA     VSA E+A         S   +  T   TS
Sbjct: 876  SASTSASVSASESASTSASVSASESASTSASVSASESA-------STSASVSASTSASTS 928

Query: 677  SSEDACASSQTPAAQRISGTLSTPAHAGALAVAAGNGDVNIVGREANLQRQSSACLGATG 856
            +S  A  S+ T A+   S + ST A   A   A+ +  V+     A+     SA   A+ 
Sbjct: 929  ASVSASESASTSASVSASESASTSASVSASESASTSASVS-ASESASTSASVSASTSAST 987

Query: 857  S 859
            S
Sbjct: 988  S 988

 Score = 35.8 bits (81), Expect = 1.1
 Identities = 42/184 (22%), Positives = 72/184 (38%), Gaps = 3/184 (1%)
 Frame = +2

Query: 317  ADSDSVISPRPTMSASPDDGASFRLKRSLTLDPSGLTATESGLQLLQVCCSCPQTAGDKQ 496
            A + + +S   + S S    AS     S ++  S   +T + +   +   S   +    +
Sbjct: 2671 ASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASE-SASTSASVSASE 2729

Query: 497  STEPCVSCATARSASPPPTPFVAPSAVNQDVVSAFEAAHKLAVAPGDSVFRNQDTIIETS 676
            S     S + + SAS   +   + SA     VSA E+A   + +   S   +  T    S
Sbjct: 2730 SASTSASVSASESASTSASVSASTSASTSASVSANESA---STSASVSASESASTSASVS 2786

Query: 677  SSEDACASSQTPAAQRISGTLSTPAHAGA---LAVAAGNGDVNIVGREANLQRQSSACLG 847
            +SE A  S+   A++  S + S  A   A    +V+A           AN    +SA + 
Sbjct: 2787 ASESASTSASVSASESASTSASVSASESASTSASVSASTSASTSASVSANESASTSASVS 2846

Query: 848  ATGS 859
            A+ S
Sbjct: 2847 ASES 2850

 Score = 35.8 bits (81), Expect = 1.1
 Identities = 46/195 (23%), Positives = 76/195 (38%), Gaps = 14/195 (7%)
 Frame = +2

Query: 317  ADSDSVISPRPTMSASPDDGASFRLKRSLTLDPSGLTATESGLQLLQ-VCCSCPQTAGDK 493
            A + + +S   + S S    AS     S ++  S  T+T + +   +    S   +A + 
Sbjct: 2587 ASTSASVSASESASTSASVSASMSASTSASVSVSESTSTSASVSANESASTSASVSASES 2646

Query: 494  QSTEPCVSCA----------TARSASPPPTPFVAPSAVNQDVVSAFEAAHKLAVAPGDSV 643
             ST   VS +           + SAS   +   + SA     VSA E+A   + +   S 
Sbjct: 2647 ASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASESA---STSASVSA 2703

Query: 644  FRNQDTIIETSSSEDACASSQTPAAQRISGTLSTPAHAGA---LAVAAGNGDVNIVGREA 814
              +  T    S+SE A  S+   A++  S + S  A   A    +V+A           A
Sbjct: 2704 SESASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASTSASTSASVSA 2763

Query: 815  NLQRQSSACLGATGS 859
            N    +SA + A+ S
Sbjct: 2764 NESASTSASVSASES 2778

 Score = 35.4 bits (80), Expect = 1.4
 Identities = 42/182 (23%), Positives = 72/182 (39%), Gaps = 1/182 (0%)
 Frame = +2

Query: 317  ADSDSVISPRPTMSASPDDGASFRLKRSLTLDPSGLTATESGLQLLQVCCSCPQTAGDKQ 496
            A + + +S   + S S    AS     S ++  S   +T + +   +   S   +    +
Sbjct: 2299 ASTSASVSASESASTSASVSASESASTSASVSASTSASTSASVSASE-SASTSASVSSSE 2357

Query: 497  STEPCVSCATARSASPPPTPFVAPSAVNQDVVSAFEAAHKLA-VAPGDSVFRNQDTIIET 673
            S     S + + SAS   +   + SA     VSA E+A   A V+  +S   +      T
Sbjct: 2358 SASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSAST 2417

Query: 674  SSSEDACASSQTPAAQRISGTLSTPAHAGALAVAAGNGDVNIVGREANLQRQSSACLGAT 853
            S+S  A  S+   A+   S + S  A   A +V+A           A+    +SA + A+
Sbjct: 2418 SASTSASVSASESASTSASVSASESASTSA-SVSASESASTSASVSASESASTSASVSAS 2476

Query: 854  GS 859
             S
Sbjct: 2477 TS 2478

 Score = 35.4 bits (80), Expect = 1.4
 Identities = 46/182 (25%), Positives = 76/182 (41%), Gaps = 1/182 (0%)
 Frame = +2

Query: 317  ADSDSVISPRPTMSASPDDGASFRLKRSLTLDPSGLTATESGLQLLQ-VCCSCPQTAGDK 493
            A + + +S   + S S    AS     S ++  S   +T + +   +    S  ++A + 
Sbjct: 1105 ASTSASVSASESSSTSASVSASESSSTSASVSASESASTSASVSASESASTSASESASES 1164

Query: 494  QSTEPCVSCATARSASPPPTPFVAPSAVNQDVVSAFEAAHKLAVAPGDSVFRNQDTIIET 673
             ST   VS   + SAS   +   + SA     VSA E     +V+   SV  ++     T
Sbjct: 1165 ASTSASVSA--SESASTSASVSASESASTSASVSASE-----SVSTSASVSASESA--ST 1215

Query: 674  SSSEDACASSQTPAAQRISGTLSTPAHAGALAVAAGNGDVNIVGREANLQRQSSACLGAT 853
            S+S  A  S+ T A++  S + ST A   A   A+ +  V+     A+     SA   A+
Sbjct: 1216 SASVSASESASTSASESASESASTSASVSASESASTSASVS-ASESASTSASVSASTSAS 1274

Query: 854  GS 859
             S
Sbjct: 1275 TS 1276

 Score = 35.0 bits (79), Expect = 1.8
 Identities = 42/184 (22%), Positives = 72/184 (38%), Gaps = 3/184 (1%)
 Frame = +2

Query: 317  ADSDSVISPRPTMSASPDDGASFRLKRSLTLDPSGLTATESGLQLLQVCCSCPQTAGDKQ 496
            A + + +S   + S S    AS     S ++  S   +T + +   +   S   +     
Sbjct: 1813 ASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASE-SASTSASVSAST 1871

Query: 497  STEPCVSCATARSASPPPTPFVAPSAVNQDVVSAFEAAHKLAVAPGDSVFRNQDTIIETS 676
            ST    S + + SAS   +   + SA     VSA E+A   + +   S   +  T    S
Sbjct: 1872 STSTSASVSASESASTSASVSASESASTSASVSASESA---STSASVSASESASTSASVS 1928

Query: 677  SSEDACASSQTPAAQRISGTLSTPAHAGA---LAVAAGNGDVNIVGREANLQRQSSACLG 847
            +SE A  S+   A++  S + S  A   A    +V+A           A+    +SA + 
Sbjct: 1929 ASESASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASESASTSASVS 1988

Query: 848  ATGS 859
            A+ S
Sbjct: 1989 ASTS 1992

 Score = 35.0 bits (79), Expect = 1.8
 Identities = 41/184 (22%), Positives = 72/184 (38%), Gaps = 3/184 (1%)
 Frame = +2

Query: 317  ADSDSVISPRPTMSASPDDGASFRLKRSLTLDPSGLTATESGLQLLQVCCSCPQTAGDKQ 496
            A + + +S   + S S    AS     S ++  S   +T + +   +   S   +    +
Sbjct: 1705 ASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASE-SASTSASVSASE 1763

Query: 497  STEPCVSCATARSASPPPTPFVAPSAVNQDVVSAFEAAHKLAVAPGDSVFRNQDTIIETS 676
            S     S + + SAS   +   + SA     VSA E+A   + +   S   +  T    S
Sbjct: 1764 SASTSASVSASESASTSASVSASESASTSASVSASESA---STSASVSASESASTSASVS 1820

Query: 677  SSEDACASSQTPAAQRISGTLSTPAHAGA---LAVAAGNGDVNIVGREANLQRQSSACLG 847
            +SE A  S+   A++  S + S  A   A    +V+A           A+    +SA + 
Sbjct: 1821 ASESASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASTSTSTSASVS 1880

Query: 848  ATGS 859
            A+ S
Sbjct: 1881 ASES 1884

 Score = 35.0 bits (79), Expect = 1.8
 Identities = 41/184 (22%), Positives = 70/184 (37%), Gaps = 3/184 (1%)
 Frame = +2

Query: 317  ADSDSVISPRPTMSASPDDGASFRLKRSLTLDPSGLTATESGLQLLQVCCSCPQTAGDKQ 496
            A + + +S   + S S    AS     S ++  S   +T + +       S   +    +
Sbjct: 2467 ASTSASVSASTSASTSASVSASESASTSASVSASESASTSASVSA-STSASTSASVSASE 2525

Query: 497  STEPCVSCATARSASPPPTPFVAPSAVNQDVVSAFEAAHKLAVAPGDSVFRNQDTIIETS 676
            S     S + + SAS   +   + SA     VSA E+A   + +   S   +  T    S
Sbjct: 2526 SASTSASVSASESASTSASVSASESASTSASVSASESA---STSASVSASESASTSASVS 2582

Query: 677  SSEDACASSQTPAAQRISGTLSTPAHAGA---LAVAAGNGDVNIVGREANLQRQSSACLG 847
            +SE A  S+   A++  S + S  A   A    +V+            AN    +SA + 
Sbjct: 2583 ASESASTSASVSASESASTSASVSASMSASTSASVSVSESTSTSASVSANESASTSASVS 2642

Query: 848  ATGS 859
            A+ S
Sbjct: 2643 ASES 2646

 Score = 35.0 bits (79), Expect = 1.8
 Identities = 44/182 (24%), Positives = 74/182 (40%), Gaps = 1/182 (0%)
 Frame = +2

Query: 317  ADSDSVISPRPTMSASPDDGASFRLKRSLTLDPSGLTATESGLQLLQVCCSCPQTAGDKQ 496
            A + + +S   + S S    AS     S ++  S   +T + +       S   +    +
Sbjct: 973  ASTSASVSASTSASTSASVSASTSASTSASVSASTSASTSASVSA-STSASTSASVSASE 1031

Query: 497  STEPCVSCATARSASPPPTPFVAPSAVNQDVVSAFEAAHKLA-VAPGDSVFRNQDTIIET 673
            S     S + + SAS   +   + SA     VSA E+A   A V+  +S          T
Sbjct: 1032 SASTSASVSASESASTSASVSASTSASTSASVSASESASTSASVSASESA--------ST 1083

Query: 674  SSSEDACASSQTPAAQRISGTLSTPAHAGALAVAAGNGDVNIVGREANLQRQSSACLGAT 853
            S+SE A  S+ T A+   S + ST A   A   ++ +  V+     A+    +SA + A+
Sbjct: 1084 SASESASESASTSASVSASESASTSASVSASESSSTSASVS-----ASESSSTSASVSAS 1138

Query: 854  GS 859
             S
Sbjct: 1139 ES 1140

 Score = 34.7 bits (78), Expect = 2.4
 Identities = 45/186 (24%), Positives = 76/186 (40%), Gaps = 5/186 (2%)
 Frame = +2

Query: 317  ADSDSVISPRPTMSASPDDGASFRLKRSLTLDPSGLTATESGLQLLQVCCSCPQTAGDKQ 496
            A + + +S   + S S    AS     S ++  S   +T + +       S  ++A   +
Sbjct: 2053 ASTSASVSASESASTSASVSASESASTSASVSASESASTSASV-------SASKSASTSE 2105

Query: 497  STEPCVSCATARSASPPPTPFVAPSAVNQDVVSAFEAAHKLA-VAPGDSVFRNQDTI--- 664
            S     S + + SAS   +   + SA     VSA E+    A V+  DS   +   +   
Sbjct: 2106 SASTSASVSASESASTSASVSASESASTSASVSASESVSTSASVSASDSASISASVLASE 2165

Query: 665  -IETSSSEDACASSQTPAAQRISGTLSTPAHAGALAVAAGNGDVNIVGREANLQRQSSAC 841
               TS+S  A  S+ T A+   S + ST A   A   A+ +  V+     A+    +SA 
Sbjct: 2166 SASTSASVSASESASTSASVSASESASTSASVSASESASTSSSVS-----ASESASTSAS 2220

Query: 842  LGATGS 859
            + A+ S
Sbjct: 2221 VSASES 2226

 Score = 34.7 bits (78), Expect = 2.4
 Identities = 41/184 (22%), Positives = 71/184 (38%), Gaps = 3/184 (1%)
 Frame = +2

Query: 317  ADSDSVISPRPTMSASPDDGASFRLKRSLTLDPSGLTATESGLQLLQVCCSCPQTAGDKQ 496
            A + + +S   + S S    AS     S ++  S   +T + +       S   +    +
Sbjct: 1825 ASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSA-STSTSTSASVSASE 1883

Query: 497  STEPCVSCATARSASPPPTPFVAPSAVNQDVVSAFEAAHKLAVAPGDSVFRNQDTIIETS 676
            S     S + + SAS   +   + SA     VSA E+A   + +   S   +  T    S
Sbjct: 1884 SASTSASVSASESASTSASVSASESASTSASVSASESA---STSASVSASESASTSASVS 1940

Query: 677  SSEDACASSQTPAAQRISGTLSTPAHAGA---LAVAAGNGDVNIVGREANLQRQSSACLG 847
            +SE A  S+   A++  S + S  A   A    +V+A           A+    +SA + 
Sbjct: 1941 ASESASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASTSASTSASVS 2000

Query: 848  ATGS 859
            A+ S
Sbjct: 2001 ASES 2004

 Score = 34.7 bits (78), Expect = 2.4
 Identities = 42/182 (23%), Positives = 72/182 (39%), Gaps = 1/182 (0%)
 Frame = +2

Query: 317  ADSDSVISPRPTMSASPDDGASFRLKRSLTLDPSGLTATESGLQLLQVCCSCPQTAGDKQ 496
            A + + +S   + S S    AS     S ++  S   +T + +   +   S   +    +
Sbjct: 1753 ASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASE-SASTSASVSASE 1811

Query: 497  STEPCVSCATARSASPPPTPFVAPSAVNQDVVSAFEAAHKLA-VAPGDSVFRNQDTIIET 673
            S     S + + SAS   +   + SA     VSA E+A   A V+  +S   +      T
Sbjct: 1812 SASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSAST 1871

Query: 674  SSSEDACASSQTPAAQRISGTLSTPAHAGALAVAAGNGDVNIVGREANLQRQSSACLGAT 853
            S+S  A  S+   A+   S + S  A   A +V+A           A+    +SA + A+
Sbjct: 1872 STSTSASVSASESASTSASVSASESASTSA-SVSASESASTSASVSASESASTSASVSAS 1930

Query: 854  GS 859
             S
Sbjct: 1931 ES 1932

 Score = 34.7 bits (78), Expect = 2.4
 Identities = 42/182 (23%), Positives = 71/182 (38%), Gaps = 1/182 (0%)
 Frame = +2

Query: 317  ADSDSVISPRPTMSASPDDGASFRLKRSLTLDPSGLTATESGLQLLQVCCSCPQTAGDKQ 496
            A + + +S   + S S    AS     S ++  S   +T + +       S   +    +
Sbjct: 2707 ASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSA-STSASTSASVSANE 2765

Query: 497  STEPCVSCATARSASPPPTPFVAPSAVNQDVVSAFEAAHKLA-VAPGDSVFRNQDTIIET 673
            S     S + + SAS   +   + SA     VSA E+A   A V+  +S   +      T
Sbjct: 2766 SASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSAST 2825

Query: 674  SSSEDACASSQTPAAQRISGTLSTPAHAGALAVAAGNGDVNIVGREANLQRQSSACLGAT 853
            S+S  A  S+   A+   S + S  A   A +V+A           A+    +SA + A+
Sbjct: 2826 SASTSASVSANESASTSASVSASESASTSA-SVSASESASTSASVSASESASTSASVSAS 2884

Query: 854  GS 859
             S
Sbjct: 2885 ES 2886

 Score = 34.7 bits (78), Expect = 2.4
 Identities = 41/184 (22%), Positives = 72/184 (38%), Gaps = 3/184 (1%)
 Frame = +2

Query: 317  ADSDSVISPRPTMSASPDDGASFRLKRSLTLDPSGLTATESGLQLLQVCCSCPQTAGDKQ 496
            A + + +S   + S S    AS     S ++  S   +T + +   +   S   +    +
Sbjct: 1537 ASTSASVSASESASTSASVSASTSASTSASVSASESASTSASVSASE-SASTSASVSASE 1595

Query: 497  STEPCVSCATARSASPPPTPFVAPSAVNQDVVSAFEAAHKLAVAPGDSVFRNQDTIIETS 676
            S     S + + SAS   +   + SA     VSA E+A   + +   S   +  T    S
Sbjct: 1596 SASTSASVSASESASTSASVSASESASTSASVSASESA---STSASVSASESASTSASVS 1652

Query: 677  SSEDACASSQTPAAQRISGTLSTPAHAGA---LAVAAGNGDVNIVGREANLQRQSSACLG 847
            +SE A  S+   A++  S + S  A   A    +V+A           A+    +SA + 
Sbjct: 1653 ASESASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASESASTSASVS 1712

Query: 848  ATGS 859
            A+ S
Sbjct: 1713 ASES 1716

 Score = 34.7 bits (78), Expect = 2.4
 Identities = 43/181 (23%), Positives = 71/181 (38%)
 Frame = +2

Query: 317  ADSDSVISPRPTMSASPDDGASFRLKRSLTLDPSGLTATESGLQLLQVCCSCPQTAGDKQ 496
            A + + +S   + S S    AS     S ++  S   +T + +       S   +    +
Sbjct: 2371 ASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSA-STSASTSASVSASE 2429

Query: 497  STEPCVSCATARSASPPPTPFVAPSAVNQDVVSAFEAAHKLAVAPGDSVFRNQDTIIETS 676
            S     S + + SAS   +   + SA     VSA E+A         S   +  T   TS
Sbjct: 2430 SASTSASVSASESASTSASVSASESASTSASVSASESA-------STSASVSASTSASTS 2482

Query: 677  SSEDACASSQTPAAQRISGTLSTPAHAGALAVAAGNGDVNIVGREANLQRQSSACLGATG 856
            +S  A  S+ T A+   S + ST A   A   A+ +  V+     A+    +SA + A+ 
Sbjct: 2483 ASVSASESASTSASVSASESASTSASVSASTSASTSASVS-----ASESASTSASVSASE 2537

Query: 857  S 859
            S
Sbjct: 2538 S 2538

 Score = 34.7 bits (78), Expect = 2.4
 Identities = 43/181 (23%), Positives = 70/181 (37%)
 Frame = +2

Query: 317  ADSDSVISPRPTMSASPDDGASFRLKRSLTLDPSGLTATESGLQLLQVCCSCPQTAGDKQ 496
            A + + +S   + S S    AS     S ++  S   +T + +   +   S   +    +
Sbjct: 2311 ASTSASVSASESASTSASVSASTSASTSASVSASESASTSASVSSSE-SASTSASVSASE 2369

Query: 497  STEPCVSCATARSASPPPTPFVAPSAVNQDVVSAFEAAHKLAVAPGDSVFRNQDTIIETS 676
            S     S + + SAS   +   + SA     VSA E+A         S   +  T   TS
Sbjct: 2370 SASTSASVSASESASTSASVSASESASTSASVSASESA-------STSASVSASTSASTS 2422

Query: 677  SSEDACASSQTPAAQRISGTLSTPAHAGALAVAAGNGDVNIVGREANLQRQSSACLGATG 856
            +S  A  S+ T A+   S + ST A   A   A+ +  V+     A+     SA   A+ 
Sbjct: 2423 ASVSASESASTSASVSASESASTSASVSASESASTSASVS-ASESASTSASVSASTSAST 2481

Query: 857  S 859
            S
Sbjct: 2482 S 2482

 Score = 34.7 bits (78), Expect = 2.4
 Identities = 42/182 (23%), Positives = 72/182 (39%), Gaps = 1/182 (0%)
 Frame = +2

Query: 317  ADSDSVISPRPTMSASPDDGASFRLKRSLTLDPSGLTATESGLQLLQVCCSCPQTAGDKQ 496
            A + + +S   + S S    AS     S ++  S   +T + +   +   S   +    +
Sbjct: 2215 ASTSASVSASESASTSASVSASTSASTSASVSASESASTSASVSASE-SASTSASVSASE 2273

Query: 497  STEPCVSCATARSASPPPTPFVAPSAVNQDVVSAFEAAHKLA-VAPGDSVFRNQDTIIET 673
            S     S + + SAS   +   + SA     VSA E+A   A V+  +S   +      T
Sbjct: 2274 SASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSAST 2333

Query: 674  SSSEDACASSQTPAAQRISGTLSTPAHAGALAVAAGNGDVNIVGREANLQRQSSACLGAT 853
            S+S  A  S+   A+   S + S  A   A +V+A           A+    +SA + A+
Sbjct: 2334 SASTSASVSASESASTSASVSSSESASTSA-SVSASESASTSASVSASESASTSASVSAS 2392

Query: 854  GS 859
             S
Sbjct: 2393 ES 2394

 Score = 34.3 bits (77), Expect = 3.1
 Identities = 41/184 (22%), Positives = 72/184 (38%), Gaps = 3/184 (1%)
 Frame = +2

Query: 317  ADSDSVISPRPTMSASPDDGASFRLKRSLTLDPSGLTATESGLQLLQVCCSCPQTAGDKQ 496
            A + + +S   + S S    AS     S ++  S   +T + +   +   S   +    +
Sbjct: 1909 ASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASE-SASTSASVSASE 1967

Query: 497  STEPCVSCATARSASPPPTPFVAPSAVNQDVVSAFEAAHKLAVAPGDSVFRNQDTIIETS 676
            S     S + + SAS   +   + SA     VSA E+A   + +   S   +  T    S
Sbjct: 1968 SASTSASVSASESASTSASVSASTSASTSASVSASESA---STSASVSASESASTSASVS 2024

Query: 677  SSEDACASSQTPAAQRISGTLSTPAHAGA---LAVAAGNGDVNIVGREANLQRQSSACLG 847
            +SE A  S+   A++  S + S  A   A    +V+A           A+    +SA + 
Sbjct: 2025 ASESASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASESASTSASVS 2084

Query: 848  ATGS 859
            A+ S
Sbjct: 2085 ASES 2088

 Score = 34.3 bits (77), Expect = 3.1
 Identities = 43/181 (23%), Positives = 72/181 (39%)
 Frame = +2

Query: 317  ADSDSVISPRPTMSASPDDGASFRLKRSLTLDPSGLTATESGLQLLQVCCSCPQTAGDKQ 496
            A + + +S   + S S    AS     S ++  S   +T + +   +   S   +    +
Sbjct: 1885 ASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASE-SASTSASVSASE 1943

Query: 497  STEPCVSCATARSASPPPTPFVAPSAVNQDVVSAFEAAHKLAVAPGDSVFRNQDTIIETS 676
            S     S + + SAS   +   + SA     VSA E+A         S   +  T   TS
Sbjct: 1944 SASTSASVSASESASTSASVSASESASTSASVSASESA-------STSASVSASTSASTS 1996

Query: 677  SSEDACASSQTPAAQRISGTLSTPAHAGALAVAAGNGDVNIVGREANLQRQSSACLGATG 856
            +S  A  S+ T A+   S + ST A   A   A+ +  V+     A+    +SA + A+ 
Sbjct: 1997 ASVSASESASTSASVSASESASTSASVSASESASTSASVS-----ASESASTSASVSASE 2051

Query: 857  S 859
            S
Sbjct: 2052 S 2052

 Score = 34.3 bits (77), Expect = 3.1
 Identities = 42/182 (23%), Positives = 71/182 (38%), Gaps = 1/182 (0%)
 Frame = +2

Query: 317  ADSDSVISPRPTMSASPDDGASFRLKRSLTLDPSGLTATESGLQLLQVCCSCPQTAGDKQ 496
            A + + +S   + S S    AS     S ++  S   +T + +   +   S   +    +
Sbjct: 889  ASTSASVSASESASTSASVSASESASTSASVSASTSASTSASVSASE-SASTSASVSASE 947

Query: 497  STEPCVSCATARSASPPPTPFVAPSAVNQDVVSAFEAAHKLA-VAPGDSVFRNQDTIIET 673
            S     S + + SAS   +   + SA     VSA  +A   A V+   S   +      T
Sbjct: 948  SASTSASVSASESASTSASVSASESASTSASVSASTSASTSASVSASTSASTSASVSAST 1007

Query: 674  SSSEDACASSQTPAAQRISGTLSTPAHAGALAVAAGNGDVNIVGREANLQRQSSACLGAT 853
            S+S  A  S+ T A+   S + S  A   A +V+A           A+    +SA + A+
Sbjct: 1008 SASTSASVSASTSASTSASVSASESASTSA-SVSASESASTSASVSASTSASTSASVSAS 1066

Query: 854  GS 859
             S
Sbjct: 1067 ES 1068

 Score = 34.3 bits (77), Expect = 3.1
 Identities = 41/184 (22%), Positives = 72/184 (38%), Gaps = 3/184 (1%)
 Frame = +2

Query: 317  ADSDSVISPRPTMSASPDDGASFRLKRSLTLDPSGLTATESGLQLLQVCCSCPQTAGDKQ 496
            A + + +S   + S S    AS     S ++  S   +T + +   +   S   +    +
Sbjct: 1645 ASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASE-SASTSASVSASE 1703

Query: 497  STEPCVSCATARSASPPPTPFVAPSAVNQDVVSAFEAAHKLAVAPGDSVFRNQDTIIETS 676
            S     S + + SAS   +   + SA     VSA E+A   + +   S   +  T    S
Sbjct: 1704 SASTSASVSASESASTSASVSASESASTSASVSASESA---STSASVSASESASTSASVS 1760

Query: 677  SSEDACASSQTPAAQRISGTLSTPAHAGA---LAVAAGNGDVNIVGREANLQRQSSACLG 847
            +SE A  S+   A++  S + S  A   A    +V+A           A+    +SA + 
Sbjct: 1761 ASESASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASESASTSASVS 1820

Query: 848  ATGS 859
            A+ S
Sbjct: 1821 ASES 1824

 Score = 34.3 bits (77), Expect = 3.1
 Identities = 41/184 (22%), Positives = 72/184 (38%), Gaps = 3/184 (1%)
 Frame = +2

Query: 317  ADSDSVISPRPTMSASPDDGASFRLKRSLTLDPSGLTATESGLQLLQVCCSCPQTAGDKQ 496
            A + + +S   + S S    AS     S ++  S   +T + +   +   S   +    +
Sbjct: 1597 ASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASE-SASTSASVSASE 1655

Query: 497  STEPCVSCATARSASPPPTPFVAPSAVNQDVVSAFEAAHKLAVAPGDSVFRNQDTIIETS 676
            S     S + + SAS   +   + SA     VSA E+A   + +   S   +  T    S
Sbjct: 1656 SASTSASVSASESASTSASVSASESASTSASVSASESA---STSASVSASESASTSASVS 1712

Query: 677  SSEDACASSQTPAAQRISGTLSTPAHAGA---LAVAAGNGDVNIVGREANLQRQSSACLG 847
            +SE A  S+   A++  S + S  A   A    +V+A           A+    +SA + 
Sbjct: 1713 ASESASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASESASTSASVS 1772

Query: 848  ATGS 859
            A+ S
Sbjct: 1773 ASES 1776

 Score = 34.3 bits (77), Expect = 3.1
 Identities = 41/184 (22%), Positives = 72/184 (38%), Gaps = 3/184 (1%)
 Frame = +2

Query: 317  ADSDSVISPRPTMSASPDDGASFRLKRSLTLDPSGLTATESGLQLLQVCCSCPQTAGDKQ 496
            A + + +S   + S S    AS     S ++  S   +T + +   +   S   +    +
Sbjct: 1561 ASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASE-SASTSASVSASE 1619

Query: 497  STEPCVSCATARSASPPPTPFVAPSAVNQDVVSAFEAAHKLAVAPGDSVFRNQDTIIETS 676
            S     S + + SAS   +   + SA     VSA E+A   + +   S   +  T    S
Sbjct: 1620 SASTSASVSASESASTSASVSASESASTSASVSASESA---STSASVSASESASTSASVS 1676

Query: 677  SSEDACASSQTPAAQRISGTLSTPAHAGA---LAVAAGNGDVNIVGREANLQRQSSACLG 847
            +SE A  S+   A++  S + S  A   A    +V+A           A+    +SA + 
Sbjct: 1677 ASESASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASESASTSASVS 1736

Query: 848  ATGS 859
            A+ S
Sbjct: 1737 ASES 1740

 Score = 34.3 bits (77), Expect = 3.1
 Identities = 39/181 (21%), Positives = 69/181 (37%)
 Frame = +2

Query: 317  ADSDSVISPRPTMSASPDDGASFRLKRSLTLDPSGLTATESGLQLLQVCCSCPQTAGDKQ 496
            A + + +S   + S S    AS     S ++  S   +T + +       S   +    +
Sbjct: 1009 ASTSASVSASTSASTSASVSASESASTSASVSASESASTSASVSA-STSASTSASVSASE 1067

Query: 497  STEPCVSCATARSASPPPTPFVAPSAVNQDVVSAFEAAHKLAVAPGDSVFRNQDTIIETS 676
            S     S + + SAS   +   + SA     VSA E+A   + +   S   +  T    S
Sbjct: 1068 SASTSASVSASESASTSASESASESASTSASVSASESA---STSASVSASESSSTSASVS 1124

Query: 677  SSEDACASSQTPAAQRISGTLSTPAHAGALAVAAGNGDVNIVGREANLQRQSSACLGATG 856
            +SE +  S+   A++  S + S  A   A + +A           A++    SA   A+ 
Sbjct: 1125 ASESSSTSASVSASESASTSASVSASESA-STSASESASESASTSASVSASESASTSASV 1183

Query: 857  S 859
            S
Sbjct: 1184 S 1184

 Score = 34.3 bits (77), Expect = 3.1
 Identities = 41/184 (22%), Positives = 71/184 (38%), Gaps = 3/184 (1%)
 Frame = +2

Query: 317  ADSDSVISPRPTMSASPDDGASFRLKRSLTLDPSGLTATESGLQLLQVCCSCPQTAGDKQ 496
            A + + +S   + S S    AS     S ++  S   +T + +       S   +    +
Sbjct: 1513 ASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSA-STSASTSASVSASE 1571

Query: 497  STEPCVSCATARSASPPPTPFVAPSAVNQDVVSAFEAAHKLAVAPGDSVFRNQDTIIETS 676
            S     S + + SAS   +   + SA     VSA E+A   + +   S   +  T    S
Sbjct: 1572 SASTSASVSASESASTSASVSASESASTSASVSASESA---STSASVSASESASTSASVS 1628

Query: 677  SSEDACASSQTPAAQRISGTLSTPAHAGA---LAVAAGNGDVNIVGREANLQRQSSACLG 847
            +SE A  S+   A++  S + S  A   A    +V+A           A+    +SA + 
Sbjct: 1629 ASESASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASESASTSASVS 1688

Query: 848  ATGS 859
            A+ S
Sbjct: 1689 ASES 1692

 Score = 34.3 bits (77), Expect = 3.1
 Identities = 43/181 (23%), Positives = 71/181 (38%)
 Frame = +2

Query: 317  ADSDSVISPRPTMSASPDDGASFRLKRSLTLDPSGLTATESGLQLLQVCCSCPQTAGDKQ 496
            A + + +S   + S S    AS     S ++  S   +T + +       S   +    +
Sbjct: 1453 ASTSTSVSTSTSASTSASVSASESASTSASVSASESASTSASVSA-STSASTSASVSASE 1511

Query: 497  STEPCVSCATARSASPPPTPFVAPSAVNQDVVSAFEAAHKLAVAPGDSVFRNQDTIIETS 676
            S     S + + SAS   +   + SA     VSA E+A         S   +  T   TS
Sbjct: 1512 SASTSASVSASESASTSASVSASESASTSASVSASESA-------STSASVSASTSASTS 1564

Query: 677  SSEDACASSQTPAAQRISGTLSTPAHAGALAVAAGNGDVNIVGREANLQRQSSACLGATG 856
            +S  A  S+ T A+   S + ST A   A   A+ +  V+     A+    +SA + A+ 
Sbjct: 1565 ASVSASESASTSASVSASESASTSASVSASESASTSASVS-----ASESASTSASVSASE 1619

Query: 857  S 859
            S
Sbjct: 1620 S 1620

 Score = 33.9 bits (76), Expect = 4.1
 Identities = 40/181 (22%), Positives = 70/181 (38%)
 Frame = +2

Query: 317  ADSDSVISPRPTMSASPDDGASFRLKRSLTLDPSGLTATESGLQLLQVCCSCPQTAGDKQ 496
            A + + +S   + S S    AS     S ++  S   +T + +       S   +    +
Sbjct: 2431 ASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSA-STSASTSASVSASE 2489

Query: 497  STEPCVSCATARSASPPPTPFVAPSAVNQDVVSAFEAAHKLAVAPGDSVFRNQDTIIETS 676
            S     S + + SAS   +   + SA     VSA E+A   + +   S   +  T    S
Sbjct: 2490 SASTSASVSASESASTSASVSASTSASTSASVSASESA---STSASVSASESASTSASVS 2546

Query: 677  SSEDACASSQTPAAQRISGTLSTPAHAGALAVAAGNGDVNIVGREANLQRQSSACLGATG 856
            +SE A  S+   A++  S + S  A   A   A+ +   +     A++    SA   A+ 
Sbjct: 2547 ASESASTSASVSASESASTSASVSASESASTSASVSASES-ASTSASVSASESASTSASV 2605

Query: 857  S 859
            S
Sbjct: 2606 S 2606

 Score = 33.9 bits (76), Expect = 4.1
 Identities = 43/189 (22%), Positives = 72/189 (37%), Gaps = 8/189 (4%)
 Frame = +2

Query: 317  ADSDSVISPRPTMSASPDDGASFRLKRSLTLDPSGLTATESGLQLLQVCCSCPQTAGDKQ 496
            A + + +S   + S S    AS     S ++  S   +T + +   +   S   +    +
Sbjct: 901  ASTSASVSASESASTSASVSASTSASTSASVSASESASTSASVSASE-SASTSASVSASE 959

Query: 497  STEPCVSCATARSASPPPTPFVAPSAVNQDVVSAFEAAHKLA-----VAPGDSVFRNQDT 661
            S     S + + SAS   +   + SA     VSA  +A   A      +   S   +  T
Sbjct: 960  SASTSASVSASESASTSASVSASTSASTSASVSASTSASTSASVSASTSASTSASVSAST 1019

Query: 662  IIETSSSEDACASSQTPAAQRISGTLSTPAHAGALAVAAGNGDVNI---VGREANLQRQS 832
               TS+S  A  S+ T A+   S + ST A   A   A+ +  V+        A++    
Sbjct: 1020 SASTSASVSASESASTSASVSASESASTSASVSASTSASTSASVSASESASTSASVSASE 1079

Query: 833  SACLGATGS 859
            SA   A+ S
Sbjct: 1080 SASTSASES 1088

 Score = 33.5 bits (75), Expect = 5.3
 Identities = 44/182 (24%), Positives = 74/182 (40%), Gaps = 1/182 (0%)
 Frame = +2

Query: 317  ADSDSVISPRPTMSASPDDGASFRLKRSLTLDPSGLTATESGLQLLQVCCSCPQTAGDKQ 496
            + + + +S   + S S    AS     S ++  S  +A+ S  +      S   +    +
Sbjct: 1117 SSTSASVSASESSSTSASVSASESASTSASVSASE-SASTSASESASESASTSASVSASE 1175

Query: 497  STEPCVSCATARSASPPPTPFVAPSAVNQDVVSAFEAAHKLA-VAPGDSVFRNQDTIIET 673
            S     S + + SAS   +   + S      VSA E+A   A V+  +S          T
Sbjct: 1176 SASTSASVSASESASTSASVSASESVSTSASVSASESASTSASVSASESA--------ST 1227

Query: 674  SSSEDACASSQTPAAQRISGTLSTPAHAGALAVAAGNGDVNIVGREANLQRQSSACLGAT 853
            S+SE A  S+ T A+   S + ST A   A   A+ +  V+     A+    +SA + A+
Sbjct: 1228 SASESASESASTSASVSASESASTSASVSASESASTSASVS-----ASTSASTSASVSAS 1282

Query: 854  GS 859
             S
Sbjct: 1283 ES 1284

 Score = 33.5 bits (75), Expect = 5.3
 Identities = 45/188 (23%), Positives = 73/188 (37%), Gaps = 7/188 (3%)
 Frame = +2

Query: 317  ADSDSVISPRPTMSASPDDGASFRLKRSLTLDPSGLTATESGLQLLQVCCSCPQTAGDKQ 496
            A + + +S   + S S    AS     S ++  S   +T + +   +   S   +    +
Sbjct: 2719 ASTSASVSASESASTSASVSASESASTSASVSASTSASTSASVSANE-SASTSASVSASE 2777

Query: 497  STEPCVSCATARSASPPPTPFVAPSAVNQDVVSAFEAAHKLA-------VAPGDSVFRNQ 655
            S     S + + SAS   +   + SA     VSA E+A   A        +   SV  N+
Sbjct: 2778 SASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASTSASTSASVSANE 2837

Query: 656  DTIIETSSSEDACASSQTPAAQRISGTLSTPAHAGALAVAAGNGDVNIVGREANLQRQSS 835
                 TS+S  A  S+ T A+   S + ST A   A   A+ +  V+     A+     S
Sbjct: 2838 SA--STSASVSASESASTSASVSASESASTSASVSASESASTSASVS-ASESASTSASVS 2894

Query: 836  ACLGATGS 859
            A   A+ S
Sbjct: 2895 ASTSASTS 2902

 Score = 33.1 bits (74), Expect = 7.0
 Identities = 41/184 (22%), Positives = 71/184 (38%), Gaps = 3/184 (1%)
 Frame = +2

Query: 317  ADSDSVISPRPTMSASPDDGASFRLKRSLTLDPSGLTATESGLQLLQVCCSCPQTAGDKQ 496
            A + + +S   + S S    AS     S ++  S   +T + +   +   S   +    +
Sbjct: 2239 ASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASE-SASTSASVSASE 2297

Query: 497  STEPCVSCATARSASPPPTPFVAPSAVNQDVVSAFEAAHKLAVAPGDSVFRNQDTIIETS 676
            S     S + + SAS   +   + SA     VSA  +A   + +   S   +  T    S
Sbjct: 2298 SASTSASVSASESASTSASVSASESASTSASVSASTSA---STSASVSASESASTSASVS 2354

Query: 677  SSEDACASSQTPAAQRISGTLSTPAHAGA---LAVAAGNGDVNIVGREANLQRQSSACLG 847
            SSE A  S+   A++  S + S  A   A    +V+A           A+    +SA + 
Sbjct: 2355 SSESASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASESASTSASVS 2414

Query: 848  ATGS 859
            A+ S
Sbjct: 2415 ASTS 2418

 Score = 32.7 bits (73), Expect = 9.1
 Identities = 44/188 (23%), Positives = 77/188 (40%), Gaps = 7/188 (3%)
 Frame = +2

Query: 317  ADSDSVISPRPTMSASPDDGASFRLKRSLTLDPSGLTATESGLQLLQVCCSCPQTAGDKQ 496
            A + + +S   + S S    AS     S ++  S   +T + +   +   S   +    +
Sbjct: 2503 ASTSASVSASTSASTSASVSASESASTSASVSASESASTSASVSASE-SASTSASVSASE 2561

Query: 497  STEPCVSCATARSASPPPTPFVAPSAVNQDVVSAFEAAH-------KLAVAPGDSVFRNQ 655
            S     S + + SAS   +   + SA     VSA E+A         ++ +   SV  ++
Sbjct: 2562 SASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASMSASTSASVSVSE 2621

Query: 656  DTIIETSSSEDACASSQTPAAQRISGTLSTPAHAGALAVAAGNGDVNIVGREANLQRQSS 835
             T   TS+S  A  S+ T A+   S + ST A   A   A+ +  V+     A+    +S
Sbjct: 2622 ST--STSASVSANESASTSASVSASESASTSASVSASESASTSASVS-----ASESASTS 2674

Query: 836  ACLGATGS 859
            A + A+ S
Sbjct: 2675 ASVSASES 2682

 Score = 32.7 bits (73), Expect = 9.1
 Identities = 45/188 (23%), Positives = 71/188 (36%), Gaps = 7/188 (3%)
 Frame = +2

Query: 317  ADSDSVISPRPTMSASPDDGASFRLKRSLTLDPSGLTATESGLQLLQVCCS----CPQTA 484
            A   + IS     S S    AS     S +   S ++A+ES      V  S       + 
Sbjct: 2151 ASDSASISASVLASESASTSASVSASESASTSAS-VSASESASTSASVSASESASTSSSV 2209

Query: 485  GDKQSTEPCVSCATARSASPPPTPFVAPSAVNQDVVSAFEAAHKLAVAPGDSVFRNQDTI 664
               +S     S + + SAS   +   + SA     VSA E+A   + +   S   +  T 
Sbjct: 2210 SASESASTSASVSASESASTSASVSASTSASTSASVSASESA---STSASVSASESASTS 2266

Query: 665  IETSSSEDACASSQTPAAQRISGTLSTPAHAGA---LAVAAGNGDVNIVGREANLQRQSS 835
               S+SE A  S+   A++  S + S  A   A    +V+A           A+    +S
Sbjct: 2267 ASVSASESASTSASVSASESASTSASVSASESASTSASVSASESASTSASVSASESASTS 2326

Query: 836  ACLGATGS 859
            A + A+ S
Sbjct: 2327 ASVSASTS 2334



EST assemble image


clone accession position
1 MXL098a08_r BP098725 1 469
2 LCL024f12_r AV627305 90 437
3 LCL087h05_r AV631033 91 558
4 LCL030a01_r AV627645 92 437
5 LCL010h10_r AV626543 93 358
6 LCL027a11_r AV627459 93 432
7 LCL019g04_r AV627010 95 437
8 LCL003c01_r AV626150 98 416
9 MXL067g10_r BP096961 100 473
10 HCL100c09_r AV645257 101 553
11 MXL022d03_r BP094386 101 385
12 HCL046d10_r AV642151 104 327
13 HCL046c11_r AV642143 104 492
14 MXL042f03_r BP095486 105 553
15 HCL066e05_r AV643262 105 578
16 LCL037d03_r AV628142 105 551
17 LCL003a09_r AV626141 105 428
18 LCL040a08_r AV628319 105 435
19 MXL079e10_r BP097681 105 528
20 CL58h04_r AV396226 105 642
21 HCL049g04_r AV642324 107 557
22 LCL044b06_r AV628585 115 396
23 HCL044f10_r AV642055 118 423
24 HCL092h09_r AV644723 119 478
25 LCL041f05_r AV628425 121 454
26 HCL090f11_r AV644569 123 396
27 LCL094b12_r AV631450 183 377
28 HCL033b01_r AV641410 188 560
29 CL26b08_r AV394582 189 738
30 MXL011a03_r BP093615 203 578
31 HCL071d03_r AV643540 263 739
32 MXL072h07_r BP097278 335 722
33 LCL082g02_r AV630688 420 768
34 HCL058a09_r AV642793 435 915
35 CL49h07_r AV397751 518 1039




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research