KCC000403A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000403A_C01 KCC000403A_c01
gcacgaGGCACAACGCACCGCTGTCAATGCAATTTATCGCTGGAACCTTCATTTTTATTG
AGCGAAAAATAAGCTGGCGCAGGCTTCTTCGTTTGCTTTCTTCGCGCTTGTACATTGTAG
GTGCCACTGACTTTTAACATGTGACAGAAGGGAACTGATTCCCTGCGTCGACAAGGTTCA
CTTCAGGGCACTTCTGCCCTGGTTCACTTCCACCTCCAGCTCTCGCGTGTTTTCAGACTG
TACATTGATGGGCGTTTTAATTGCAGCCATCCAACTATACGGGGCCCTGATGGTCGTGCG
CGTGGTATGGGGCAGTTTGGCACTTATTATAGCCTGCGTGGCGACTCTAATTCGCGCAGT
GCTGTCTATCGGTCGCGTGCTGCAGCTGCTATGGCTCCCCCCAAACGCCTCCACCTACAC
GGGACCCGGCACTTGGTGGGACCTCGCCTGGCGGCTACTCACGTTGAGGCCTCTGTTTGG
ACTGTTTGCTCGCGGCACGTTCATGCGAGCTTACGCCCTGATAGTCATTCCGGTCCTGGG
CGTGTGGGCCGTCGGCATCGCTGCCCTGCTCGCGCGCGCGGACCTGCTGAAGCCCCTGGT
CAAATCGCTGCCGCTGCTGTCGTGTGTGGCGCTGTGTCTGATGTCGCTGGCTCTGGCTGA
CGACGCTGTGCGGCGCCTGCTGCTGCCGGGGCGGCTGTGCATGGCAGCGCTGCGGGGCAG
TGCCGCGGCCTGGATGGGGCTGCTCGGGTGGCTGGGCACAATGGCGCAGTTTGAGCCGGG
TGTGTCCAAGTATGAGGTGGCGGAACTGTCATCGGTGCTTGCGCTGTGCAGCGGGGCGGC
GGTGTTTG


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000403A_C01 KCC000403A_c01
         (848 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

gb|AAO50779.1| similar to Mus musculus (Mouse). Sex-determining ...    52  1e-05
ref|XP_330041.1| hypothetical protein [Neurospora crassa] gi|289...    49  1e-04
gb|AAL16979.1| 50kD gamma zein [Zea mays]                              48  2e-04
ref|NP_627107.1| putative membrane protein [Streptomyces coelico...    48  2e-04
gb|AAL92636.2|AC115680_6 similar to unknown protein; protein id:...    46  7e-04

>gb|AAO50779.1| similar to Mus musculus (Mouse). Sex-determining region Y protein
            (Testis-determining factor) [Dictyostelium discoideum]
          Length = 1461

 Score = 52.0 bits (123), Expect = 1e-05
 Identities = 39/156 (25%), Positives = 60/156 (38%)
 Frame = -2

Query: 754  QPPEQPHPGRGTAPQRCHAQPPRQQQAPHSVVSQSQRHQTQRHTRQQRQRFDQGLQQVRA 575
            QP +QPH  +    Q+ H QP  QQQ   +   Q Q+HQ  +H +QQ+ +  Q  QQ + 
Sbjct: 945  QPHQQPHQHQQQQHQQPHQQPHHQQQHHQNNHQQHQQHQQHQHHQQQQLQQQQQQQQQQQ 1004

Query: 574  REQGSDADGPHAQDRNDYQGVSSHERAASKQSKQRPQRE*PPGEVPPSAGSRVGGGVWGE 395
              Q       H Q +   Q     ++   +Q +Q+ Q +    +                
Sbjct: 1005 HHQ-HQQHHHHQQQQQQQQQQQQQQQQQQQQQQQQQQHQQQQQQQ--------------- 1048

Query: 394  P*QLQHATDRQHCAN*SRHAGYNKCQTAPYHAHDHQ 287
              Q QH   +QH     +H  +        H H HQ
Sbjct: 1049 --QQQHQHQQQHQHQQHQHQQHQHQHQQHQHQHQHQ 1082

 Score = 47.0 bits (110), Expect = 4e-04
 Identities = 40/186 (21%), Positives = 71/186 (37%)
 Frame = -2

Query: 844  HRRPAAQRKHR*QFRHLILGHTRLKLRHCAQPPEQPHPGRGTAPQRCHAQPPRQQQAPHS 665
            H++P   ++ + Q  H    H +   ++  Q  +Q    +    Q+   Q  +QQQ  H 
Sbjct: 947  HQQPHQHQQQQHQQPHQQPHHQQQHHQNNHQQHQQHQQHQHHQQQQLQQQQQQQQQQQHH 1006

Query: 664  VVSQSQRHQTQRHTRQQRQRFDQGLQQVRAREQGSDADGPHAQDRNDYQGVSSHERAASK 485
               Q   HQ Q+  +QQ+Q+  Q  QQ + ++Q         Q ++ +Q    H++   +
Sbjct: 1007 QHQQHHHHQQQQQQQQQQQQQQQQQQQQQQQQQQHQQQQQQQQQQHQHQQQHQHQQHQHQ 1066

Query: 484  QSKQRPQRE*PPGEVPPSAGSRVGGGVWGEP*QLQHATDRQHCAN*SRHAGYNKCQTAPY 305
            Q + + Q+                        Q QH    QH     +H   ++ Q    
Sbjct: 1067 QHQHQHQQH-----------------------QHQHQHQHQH-----QHQHQHQHQHQHQ 1098

Query: 304  HAHDHQ 287
            H H HQ
Sbjct: 1099 HQHQHQ 1104

 Score = 39.3 bits (90), Expect = 0.082
 Identities = 31/122 (25%), Positives = 49/122 (39%)
 Frame = -2

Query: 826  QRKHR*QFRHLILGHTRLKLRHCAQPPEQPHPGRGTAPQRCHAQPPRQQQAPHSVVSQSQ 647
            Q+ H+ Q  H    H + + +   Q  +Q    +    Q+ H Q  +QQQ  H      Q
Sbjct: 1003 QQHHQHQQHH---HHQQQQQQQQQQQQQQQQQQQQQQQQQQHQQQQQQQQQQHQ---HQQ 1056

Query: 646  RHQTQRHTRQQRQRFDQGLQQVRAREQGSDADGPHAQDRNDYQGVSSHERAASKQSKQRP 467
            +HQ Q+H  QQ Q   Q  Q     +        H Q ++ +Q    H+     Q  Q+ 
Sbjct: 1057 QHQHQQHQHQQHQHQHQQHQHQHQHQHQHQHQHQH-QHQHQHQHQHQHQHQHQHQQHQQH 1115

Query: 466  QR 461
            Q+
Sbjct: 1116 QQ 1117

 Score = 35.8 bits (81), Expect = 0.91
 Identities = 29/133 (21%), Positives = 52/133 (38%), Gaps = 3/133 (2%)
 Frame = -2

Query: 847  KHRRPAAQRKHR*QFRHLILGHTRLKLRHCAQPPEQPHPGRGTAPQRCHAQPPRQQQAPH 668
            +H+    Q+  + Q +     H + +  H  Q  +Q    +    Q+   Q  +QQQ   
Sbjct: 984  QHQHHQQQQLQQQQQQQQQQQHHQHQQHHHHQQQQQQQQQQQQQQQQQQQQQQQQQQHQQ 1043

Query: 667  SVVSQSQRHQTQ---RHTRQQRQRFDQGLQQVRAREQGSDADGPHAQDRNDYQGVSSHER 497
                Q Q+HQ Q   +H + Q Q+     QQ + + Q         Q ++ +Q    H+ 
Sbjct: 1044 QQQQQQQQHQHQQQHQHQQHQHQQHQHQHQQHQHQHQHQHQHQHQHQHQHQHQHQHQHQH 1103

Query: 496  AASKQSKQRPQRE 458
                Q +Q  Q +
Sbjct: 1104 QHQHQHQQHQQHQ 1116

 Score = 35.0 bits (79), Expect = 1.5
 Identities = 26/100 (26%), Positives = 43/100 (43%), Gaps = 2/100 (2%)
 Frame = -2

Query: 751  PPEQPHPGRGTAPQRCHAQPPRQQQAPHSVVSQSQRHQTQRHTRQQRQRFDQGLQQVRAR 572
            P + P   +    Q+   Q  +QQQ P     Q  +HQ   H +QQ+Q   Q  Q  + +
Sbjct: 901  PTDHPIQQQQQQQQQQQQQQQQQQQQPQPQQLQLPQHQ---HQQQQQQPHQQPHQHQQQQ 957

Query: 571  EQGSDADGPHAQD--RNDYQGVSSHERAASKQSKQRPQRE 458
             Q       H Q   +N++Q    H++    Q +Q  Q++
Sbjct: 958  HQQPHQQPHHQQQHHQNNHQQHQQHQQHQHHQQQQLQQQQ 997

 Score = 34.7 bits (78), Expect = 2.0
 Identities = 26/103 (25%), Positives = 41/103 (39%)
 Frame = -2

Query: 826  QRKHR*QFRHLILGHTRLKLRHCAQPPEQPHPGRGTAPQRCHAQPPRQQQAPHSVVSQSQ 647
            Q++H+ Q +H    H   + +H  Q  +  H  +     +   Q   Q Q  H    Q Q
Sbjct: 1049 QQQHQHQQQHQHQQHQHQQHQHQHQQHQHQHQHQHQHQHQHQHQHQHQHQHQHQHQHQHQ 1108

Query: 646  RHQTQRHTRQQRQRFDQGLQQVRAREQGSDADGPHAQDRNDYQ 518
              Q Q+H + Q+Q   Q  Q    + Q       H Q+  +YQ
Sbjct: 1109 HQQHQQHQQHQQQHHHQQNQHHHQQNQ-------HQQNTMNYQ 1144

>ref|XP_330041.1| hypothetical protein [Neurospora crassa] gi|28925911|gb|EAA34907.1|
           hypothetical protein [Neurospora crassa]
          Length = 993

 Score = 48.9 bits (115), Expect = 1e-04
 Identities = 32/102 (31%), Positives = 44/102 (42%)
 Frame = -2

Query: 754 QPPEQPHPGRGTAPQRCHAQPPRQQQAPHSVVSQSQRHQTQRHTRQQRQRFDQGLQQVRA 575
           Q P+Q H  +    Q    Q  RQQQ       Q Q+HQ Q   + Q+Q   Q  QQ + 
Sbjct: 191 QQPQQLHQQQQQQQQEQQQQQQRQQQRQQQ---QQQQHQQQHQQQHQQQHQQQHQQQHQQ 247

Query: 574 REQGSDADGPHAQDRNDYQGVSSHERAASKQSKQRPQRE*PP 449
           + Q       + Q ++ YQ    H     +Q +Q PQR  PP
Sbjct: 248 QHQQQQHQPIYLQQQHQYQHQQYHHHQQQQQQQQHPQR--PP 287

 Score = 37.4 bits (85), Expect = 0.31
 Identities = 22/85 (25%), Positives = 40/85 (46%)
 Frame = -2

Query: 712 QRCHAQPPRQQQAPHSVVSQSQRHQTQRHTRQQRQRFDQGLQQVRAREQGSDADGPHAQD 533
           Q+   Q  +QQQ       Q Q+ Q Q+  +QQ+Q+  Q  QQ +  +Q       H Q 
Sbjct: 134 QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQPQQQQQQQQQTQQYQHQQFLHQQP 193

Query: 532 RNDYQGVSSHERAASKQSKQRPQRE 458
           +  +Q     ++   +Q +++ QR+
Sbjct: 194 QQLHQQQQQQQQEQQQQQQRQQQRQ 218

 Score = 37.0 bits (84), Expect = 0.41
 Identities = 28/106 (26%), Positives = 48/106 (44%), Gaps = 7/106 (6%)
 Frame = -2

Query: 754 QPPEQPHPGRGTAPQRCHAQPPRQQQAPHSVVSQSQRHQ-------TQRHTRQQRQRFDQ 596
           Q  +Q    +    Q+   Q P+QQQ       Q Q HQ        Q H +QQ+Q+ +Q
Sbjct: 149 QQQQQQQQQQQQQQQQQQQQQPQQQQQQQQQTQQYQ-HQQFLHQQPQQLHQQQQQQQQEQ 207

Query: 595 GLQQVRAREQGSDADGPHAQDRNDYQGVSSHERAASKQSKQRPQRE 458
             QQ R +++       H Q ++  Q    H++   +Q +Q+ Q++
Sbjct: 208 QQQQQRQQQRQQQQQQQH-QQQHQQQHQQQHQQQHQQQHQQQHQQQ 252

 Score = 34.7 bits (78), Expect = 2.0
 Identities = 24/103 (23%), Positives = 43/103 (41%), Gaps = 4/103 (3%)
 Frame = -2

Query: 754 QPPEQPHPGRGTAPQRCHAQPPRQQQAPHSVVSQSQRHQTQRHTRQQRQRF----DQGLQ 587
           Q  +Q    +    Q+   Q  +QQQ       Q Q+ Q Q+  + Q Q+F     Q L 
Sbjct: 138 QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQPQQQQQQQQQTQQYQHQQFLHQQPQQLH 197

Query: 586 QVRAREQGSDADGPHAQDRNDYQGVSSHERAASKQSKQRPQRE 458
           Q + ++Q         Q +   Q    H++   +Q +Q+ Q++
Sbjct: 198 QQQQQQQQEQQQQQQRQQQRQQQQQQQHQQQHQQQHQQQHQQQ 240

>gb|AAL16979.1| 50kD gamma zein [Zea mays]
          Length = 295

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 33/120 (27%), Positives = 49/120 (40%), Gaps = 12/120 (10%)
 Frame = -2

Query: 784 HTRLKLRHCAQPPEQPHPGRGTAPQRCHAQPPR------------QQQAPHSVVSQSQRH 641
           H   K +H  QPP Q H  +    Q+ H QP +            QQQ  H    Q Q+H
Sbjct: 42  HHPQKQQH--QPPPQHHQQQQHQQQQVHMQPQKHQQQQEVHVQQQQQQPQHQQQQQQQQH 99

Query: 640 QTQRHTRQQRQRFDQGLQQVRAREQGSDADGPHAQDRNDYQGVSSHERAASKQSKQRPQR 461
           Q Q     Q+Q   Q    V+  EQ  +     + ++   Q    H++   +Q  Q+PQ+
Sbjct: 100 QQQHQCEGQQQHHQQSQGHVQQHEQSHEQHQGQSHEQQHQQQFQGHDK---QQQPQQPQQ 156

 Score = 40.8 bits (94), Expect = 0.028
 Identities = 29/107 (27%), Positives = 46/107 (42%), Gaps = 8/107 (7%)
 Frame = -2

Query: 754 QPPEQPHPGRGTAPQRCHAQPP-----RQQQAPHSVVSQSQRHQTQRHT---RQQRQRFD 599
           Q  EQ H  +   PQ+   QPP     +QQ     V  Q Q+HQ Q+     +QQ+Q   
Sbjct: 31  QSHEQQHHPQQHHPQKQQHQPPPQHHQQQQHQQQQVHMQPQKHQQQQEVHVQQQQQQPQH 90

Query: 598 QGLQQVRAREQGSDADGPHAQDRNDYQGVSSHERAASKQSKQRPQRE 458
           Q  QQ +  +Q    +G     +     V  HE++  +   Q  +++
Sbjct: 91  QQQQQQQQHQQQHQCEGQQQHHQQSQGHVQQHEQSHEQHQGQSHEQQ 137

>ref|NP_627107.1| putative membrane protein [Streptomyces coelicolor A3(2)]
           gi|7635985|emb|CAB88820.1| putative membrane protein
           [Streptomyces coelicolor A3(2)]
          Length = 551

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 36/102 (35%), Positives = 44/102 (42%)
 Frame = -1

Query: 842 PPPRCTAQAPMTVPPPHTWTHPAQTAPLCPATRAAPSRPRHCPAALPCTAAPAAAGAAQR 663
           P    ++ AP   P P     PA  A   PA  AAP  P   PAA P T+   A  AA  
Sbjct: 403 PAVAASSVAPPLAPAPEAGV-PASAAVAGPAVPAAPGEPVAEPAAAPATSPAGAPAAAS- 460

Query: 662 RQPEPATSDTAPHTTAAAAI*PGASAGPRARAGQRCRRPTRP 537
             P+PAT  +A  T   A+   G +   R+ A    RRP  P
Sbjct: 461 -VPDPATPTSAATTATTAS---GLTVRRRSAAPAPARRPAAP 498

 Score = 38.1 bits (87), Expect = 0.18
 Identities = 30/84 (35%), Positives = 34/84 (39%), Gaps = 14/84 (16%)
 Frame = -1

Query: 824 AQAPMTVPPPHTWTHPAQTAPLC-----------PATRAAPSRPRHCPAALPCTAAPAAA 678
           A A  +VP P T T  A TA              PA    P+ P       P  AA  AA
Sbjct: 455 APAAASVPDPATPTSAATTATTASGLTVRRRSAAPAPARRPAAPDDTEPGRPAVAAAWAA 514

Query: 677 GAAQRR---QPEPATSDTAPHTTA 615
           G  + R   QP PA + TA HT A
Sbjct: 515 GTRRGRDGEQPSPAPAGTATHTAA 538

>gb|AAL92636.2|AC115680_6 similar to unknown protein; protein id: At1g65440.1 [Arabidopsis
            thaliana] [Dictyostelium discoideum]
          Length = 1757

 Score = 46.2 bits (108), Expect = 7e-04
 Identities = 36/117 (30%), Positives = 56/117 (47%), Gaps = 10/117 (8%)
 Frame = -2

Query: 754  QPP------EQPHPGR--GTAPQRCHAQPPRQQQAPHSVVSQSQRHQTQRHTRQ--QRQR 605
            QPP      +QP P +  G  PQ+   QP  Q + P+    Q Q+ Q Q + +Q  Q+Q+
Sbjct: 1570 QPPPQSVYQQQPQPNQPYGQMPQQ---QPYSQGRPPYQQPPQQQQQQQQPYQQQPPQQQQ 1626

Query: 604  FDQGLQQVRAREQGSDADGPHAQDRNDYQGVSSHERAASKQSKQRPQRE*PPGEVPP 434
              Q  QQ    +Q      P + + N YQ      +   +Q +QRP ++ P G++PP
Sbjct: 1627 PQQQQQQYNPYQQQQPPQRPQSWNDNQYQ------QQQPQQYQQRPPQQQPYGQMPP 1677



EST assemble image


clone accession position
1 CL26b05_r AV394602 1 454
2 LCL087b03_r AV630975 4 433
3 HCL093d02_r AV644757 14 528
4 LCL050b07_r AV628999 136 617
5 HCL021d06_r AV640729 372 824
6 HCL020h09_r AV640699 372 848




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research