KCC000402A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000402A_C01 KCC000402A_c01
GTAGACTAGCGTTCGGCATTAGAGCCGAGCCCAGCACCCACTGTCGTTGCTCGTGAGCGC
GTGTTTTCCTCAGCCTAGGCGCCATGACGTGGCCGGAGCCCCCGAACTACTATGAGGCTC
CCAAGCATGGCTTCAAGGTCACGCTGGAGAACCCGACCTTTCCGATTATCAACCCGGACC
CCAACATCACGGACGCAGTCACCAACATGCGCTCGGAGAACTGGGGCGTGGTCGCTGGCC
TGGCTGGTCTGGGCTACGTAGCAGGATACTACTTCGGTGCCAAGGTGCACTGGGCCAAGC
CCACCGCTCTGTTCACCTCCATTTTCCTGGGGAAGAGCGGCCTGCTGTGGGGCATGTCGG
ACAGCGCTCACCGGCTGATGGGCTTCAAGGAGAACAGCAAGGAGGTGGCCGCCAACCTGC
CGCACGTGATGCAGCGCGAGTCCTACTAAACAGATTGGACACAGCCGCTGCAAGCAGCAG
CACCGCCGATGGCGCGGGGACTCGCGGCTGCGGCTGCAGCTGCCGTAGCAGCAGTGGTAG
GCGCTGAGGACTGGTGGATGTAGCATGGGGGCGGAGAACGAGGAGGAGCAGCAGCAGCAG
CCGCTGGAGCAAGAATGCATGGACTGTATATGCGTCCAAGGCACTGGAAACGGTGCTGCT
GGCACGCGAGGAGCTGGCGTGTAGCAGCAGCTGCGGAGCTCGATGCTGCTCCGGGATGCG
TGTTACCGCTGACAGGCACCAACAGTGGGCTGAAGGTGTGGGTAAGCGCACGTAAGCGCA
CCTTGACGCAAGAGGCCGCGAGGACAAGGGAGGAGCGGCGGTTTGGCCTCGGCAGCCCGA
ACATCTTGACCATTATGGTCTAAGGAGCTTATGAATAGAGTAGGAGGGCATGCGGTAAAA
GGAGGGTGCAATGCTGACTGAGGAAGGCCTGGATAGTGAGTATCAGGTTGAGGTGCGTGG
AGCCGGGAAACACGCAACGCACCAGTTAGGGACCGAGGTGTTTATGTGCTGTGTGATGCG
CTGTGTATGTCGGCTGTCGAGTTAGGCACGGGTGGTTACCCTGCTTGAGTCCGAAGTGT


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000402A_C01 KCC000402A_c01
         (1079 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

gb|AAQ64641.1| NADH:ubiquinone oxidoreductase 20,9 kD-like subun...   259  6e-68
gb|AAM62828.1| unknown [Arabidopsis thaliana]                          47  4e-04
ref|NP_032290.1| homeobox protein A13; hypodactyly [Mus musculus...    47  7e-04
ref|NP_567500.1| expressed protein [Arabidopsis thaliana] gi|748...    47  7e-04
sp|P31271|HXAD_HUMAN Homeobox protein Hox-A13 (Hox-1J) gi|183235...    46  0.001

>gb|AAQ64641.1| NADH:ubiquinone oxidoreductase 20,9 kD-like subunit [Chlamydomonas
           reinhardtii]
          Length = 121

 Score =  259 bits (662), Expect = 6e-68
 Identities = 121/121 (100%), Positives = 121/121 (100%)
 Frame = +3

Query: 84  MTWPEPPNYYEAPKHGFKVTLENPTFPIINPDPNITDAVTNMRSENWGVVAGLAGLGYVA 263
           MTWPEPPNYYEAPKHGFKVTLENPTFPIINPDPNITDAVTNMRSENWGVVAGLAGLGYVA
Sbjct: 1   MTWPEPPNYYEAPKHGFKVTLENPTFPIINPDPNITDAVTNMRSENWGVVAGLAGLGYVA 60

Query: 264 GYYFGAKVHWAKPTALFTSIFLGKSGLLWGMSDSAHRLMGFKENSKEVAANLPHVMQRES 443
           GYYFGAKVHWAKPTALFTSIFLGKSGLLWGMSDSAHRLMGFKENSKEVAANLPHVMQRES
Sbjct: 61  GYYFGAKVHWAKPTALFTSIFLGKSGLLWGMSDSAHRLMGFKENSKEVAANLPHVMQRES 120

Query: 444 Y 446
           Y
Sbjct: 121 Y 121

>gb|AAM62828.1| unknown [Arabidopsis thaliana]
          Length = 106

 Score = 47.4 bits (111), Expect = 4e-04
 Identities = 26/90 (28%), Positives = 44/90 (48%)
 Frame = +3

Query: 144 LENPTFPIINPDPNITDAVTNMRSENWGVVAGLAGLGYVAGYYFGAKVHWAKPTALFTSI 323
           LE P +P+++ +P  T  V N  + ++   + + G+    GY  G K     P+ +   +
Sbjct: 8   LEKPQYPVVDRNPAFTKVVGNFSTLDYLRFSTITGISVTVGYLSGIKPGIKGPSMVTGGL 67

Query: 324 FLGKSGLLWGMSDSAHRLMGFKENSKEVAA 413
                G ++   +SA RLMGF  N  EVA+
Sbjct: 68  IGLMGGFMYAYQNSAGRLMGFFPNDGEVAS 97

>ref|NP_032290.1| homeobox protein A13; hypodactyly [Mus musculus]
           gi|4033408|sp|Q62424|HXAD_MOUSE Homeobox protein Hox-A13
           (Hox-1.10) gi|1399859|gb|AAB03322.1| transcription
           factor HOXA13
          Length = 386

 Score = 46.6 bits (109), Expect = 7e-04
 Identities = 41/119 (34%), Positives = 52/119 (43%), Gaps = 3/119 (2%)
 Frame = -2

Query: 748 PLLVPVSGNTHPGAASSSAAAATRQLLACQQHRFQCLGRIYSPCILAPAAAAA---APPR 578
           P      GN    AA+++AAAA            QC   +  P  LAP AAAA   AP  
Sbjct: 61  PAAAAAGGNFSVAAAAAAAAAAAAN---------QCRNLMAHPAPLAPGAAAAYSSAPGE 111

Query: 577 SPPPCYIHQSSAPTTAATAAAAAAASPRAIGGAAACSGCVQSV**DSRCITCGRLAATS 401
           +PP      ++A   AA AAAAAAAS     G A  +G   +     +C  C   A +S
Sbjct: 112 APPSA---AAAAAAAAAAAAAAAAASSSGGPGPAGPAGAEAA----KQCSPCSAAAQSS 163

>ref|NP_567500.1| expressed protein [Arabidopsis thaliana] gi|7485078|pir||C71431
           hypothetical protein - Arabidopsis thaliana
           gi|2245001|emb|CAB10421.1| hypothetical protein
           [Arabidopsis thaliana] gi|7268395|emb|CAB78687.1|
           hypothetical protein [Arabidopsis thaliana]
          Length = 106

 Score = 46.6 bits (109), Expect = 7e-04
 Identities = 26/90 (28%), Positives = 44/90 (48%)
 Frame = +3

Query: 144 LENPTFPIINPDPNITDAVTNMRSENWGVVAGLAGLGYVAGYYFGAKVHWAKPTALFTSI 323
           LE   +P+++ +P  T  V N R+ ++   + + G+    GY  G K     P+ +   +
Sbjct: 8   LEKAQYPVVDRNPAFTKVVGNFRTLDYLRFSTITGISVTVGYLSGIKPGIKGPSMVTGGL 67

Query: 324 FLGKSGLLWGMSDSAHRLMGFKENSKEVAA 413
                G ++   +SA RLMGF  N  EVA+
Sbjct: 68  IGLMGGFMYAYQNSAGRLMGFFPNDGEVAS 97

>sp|P31271|HXAD_HUMAN Homeobox protein Hox-A13 (Hox-1J) gi|1832353|gb|AAC50993.1|
           transcription factor HOXA13 [Homo sapiens]
          Length = 388

 Score = 45.8 bits (107), Expect = 0.001
 Identities = 36/105 (34%), Positives = 46/105 (43%), Gaps = 9/105 (8%)
 Frame = -2

Query: 748 PLLVPVSGNTHPGAASSSAAAATRQLLACQQHRFQCLGRIYSPCILAPAAAAA---APPR 578
           P      GN    AA+++AAAA            QC   +  P  LAP AA+A   AP  
Sbjct: 61  PAAAAAGGNFSVAAAAAAAAAAAAN---------QCRNLMAHPAPLAPGAASAYSSAPGE 111

Query: 577 SPPPCYIHQSSAPTTAATAAAAAA------ASPRAIGGAAACSGC 461
           +PP      ++A   AA AAAA++      A P A   A  CS C
Sbjct: 112 APPSAAAAAAAAAAAAAAAAAASSSGGPGPAGPAAAEAAKQCSPC 156



EST assemble image


clone accession position
1 MX043h02_r BP087800 1 447
2 HC061f05_r AV636597 12 567
3 LC009e08_r AV619525 91 626
4 LC043a01_r AV621946 95 581
5 LC019h10_r AV620275 95 561
6 LC042c04_r AV621889 96 638
7 HC097g09_r AV639315 101 616
8 LC045a04_r AV622058 104 588
9 CM058g03_r AV390364 106 724
10 CM058g02_r AV390379 106 452
11 HC033g02_r AV634465 108 592
12 HC097a02_r AV639253 108 522
13 LC066e08_r AV623630 109 631
14 HC011e11_r AV632702 110 608
15 LC028c08_r AV620896 110 575
16 CM074d01_r AV391517 113 708
17 LC080d11_r AV624631 113 411
18 MX057b09_r BP088312 118 480
19 LC008a07_r AV619414 119 657
20 MX040b11_r BP087646 120 475
21 LC041e07_r AV621834 321 814
22 CL26a08_r AV394578 667 1189
23 CM053a11_r AV389885 973 1217




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research