KCC000301A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000301A_C01 KCC000301A_c01
aGTACATTAGGCTCACATTCAGCAAAAATGAGCAAGCCTGCTTCCTACAAGTACCTGGTG
GAGGTGGAGCCTGCGAGGCCCGCGAACGGGGACAAGCCCTCCGCGAGCCCCGTCTACCGC
AGCGTTTATGCCAAGGATGGCTTCCCTACGGCAGACTTCAAGACTCTGTTTGAGATGTTT
GAGCAGTCTGCCGCGAAGTACCCCGACAACCAGTGCCTCGGCAAGCGCGTGAAGAAGGAG
AATGGCGAGGCCGGACCCTACGTGTTCAAGAGCTACAAGGAGATCCACACGGAGGTTGCG
AACGTCGCGTCCGCGCTTCGCGCGCTGGGCGTCAATCCGGCTCAGCGCGTGGGCGTGTTC
GGTGCCAACTGCCCCGAGTGGATGGTCGCGATGCAGGCCTGCAACCGCATGGCCATGCAC
TGCGTGCCGCTGTACGACAGCCTGGGCGAGAACGCCATCGAGTACATCGTTAACCACAGC
GAGGCCGTGGCTGCCTTCGTGAGCAGCGAGAAGCTGCCGGCGCTGGCCAAGGCGCTGCCC
AAGACCAAGGCCACGCTCAAGGTGGTGGTCTACTGGGGCGCCGGCAACGAGGCGGCGGCC
AAGGCCGCCAAGGACCTGnGCTACGTGGTCCACTCGTTTGACGAGCTGCTGGCGCTGGGC
GCCGCCAAGCCCGCCGAGCCCGTGCCGCCCAAGCCCGACGACCTGTGCACCATCATGTAC
ACCAGCG


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000301A_C01 KCC000301A_c01
         (727 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|NP_192841.1| long-chain-fatty-acid--CoA ligase (acyl CoA syn...   202  3e-51
gb|AAM28872.1|AF503755_1 long chain acyl-CoA synthetase 5 [Arabi...   202  3e-51
pir||T07929 probable long-chain-fatty-acid-CoA ligase (EC 6.2.1....   190  2e-47
ref|NP_194116.1| long-chain-fatty-acid--CoA ligase (acyl-CoA syn...   189  5e-47
ref|NP_176622.1| long-chain-fatty-acid--CoA ligase (acyl-CoA syn...   188  6e-47

>ref|NP_192841.1| long-chain-fatty-acid--CoA ligase (acyl CoA synthetase), putative
           [Arabidopsis thaliana] gi|7437847|pir||T08182 probable
           long-chain-fatty-acid-CoA ligase (EC 6.2.1.3) T22B4.10
           [similarity] - Arabidopsis thaliana
           gi|4850282|emb|CAB43038.1| putative acyl-CoA synthetase
           [Arabidopsis thaliana] gi|7267801|emb|CAB81204.1|
           putative acyl-CoA synthetase [Arabidopsis thaliana]
          Length = 666

 Score =  202 bits (515), Expect = 3e-51
 Identities = 95/228 (41%), Positives = 148/228 (64%), Gaps = 2/228 (0%)
 Frame = +1

Query: 49  KYLVEVEPARPANGDKPSASPVYRSVYAKDGFPTA--DFKTLFEMFEQSAAKYPDNQCLG 222
           +++ EVE A+ A    PS  PVYRS +A++GFP      ++ +++F  +  KYP+N+ LG
Sbjct: 6   RFIFEVEAAKEATDGNPSVGPVYRSTFAQNGFPNPIDGIQSCWDIFRTAVEKYPNNRMLG 65

Query: 223 KRVKKENGEAGPYVFKSYKEIHTEVANVASALRALGVNPAQRVGVFGANCPEWMVAMQAC 402
           +R +  NG+AG YV+K+YKE++  V  + ++LR+ G+   ++ G++G NC EW+++M+AC
Sbjct: 66  RR-EISNGKAGKYVWKTYKEVYDIVIKLGNSLRSCGIKEGEKCGIYGINCCEWIISMEAC 124

Query: 403 NRMAMHCVPLYDSLGENAIEYIVNHSEAVAAFVSSEKLPALAKALPKTKATLKVVVYWGA 582
           N   ++CVPLYD+LG  A+E+I++H+E   AFV  +K+P L K  P +   +K VV +G 
Sbjct: 125 NAHGLYCVPLYDTLGAGAVEFIISHAEVSIAFVEEKKIPELFKTCPNSTKYMKTVVSFGG 184

Query: 583 GNEAAAKAAKDLXYVVHSFDELLALGAAKPAEPVPPKPDDLCTIMYTS 726
                 + A+ L  V+HS+DE L LG  K  E    KP D+CTIMYTS
Sbjct: 185 VKPEQKEEAEKLGLVIHSWDEFLKLGEGKQYELPIKKPSDICTIMYTS 232

>gb|AAM28872.1|AF503755_1 long chain acyl-CoA synthetase 5 [Arabidopsis thaliana]
          Length = 666

 Score =  202 bits (515), Expect = 3e-51
 Identities = 95/228 (41%), Positives = 148/228 (64%), Gaps = 2/228 (0%)
 Frame = +1

Query: 49  KYLVEVEPARPANGDKPSASPVYRSVYAKDGFPTA--DFKTLFEMFEQSAAKYPDNQCLG 222
           +++ EVE A+ A    PS  PVYRS +A++GFP      ++ +++F  +  KYP+N+ LG
Sbjct: 6   RFIFEVEAAKEATDGNPSVGPVYRSTFAQNGFPNPIDGIQSCWDIFRTAVEKYPNNRMLG 65

Query: 223 KRVKKENGEAGPYVFKSYKEIHTEVANVASALRALGVNPAQRVGVFGANCPEWMVAMQAC 402
           +R +  NG+AG YV+K+YKE++  V  + ++LR+ G+   ++ G++G NC EW+++M+AC
Sbjct: 66  RR-EISNGKAGKYVWKTYKEVYDIVIKLGNSLRSCGIKEGEKCGIYGINCCEWIISMEAC 124

Query: 403 NRMAMHCVPLYDSLGENAIEYIVNHSEAVAAFVSSEKLPALAKALPKTKATLKVVVYWGA 582
           N   ++CVPLYD+LG  A+E+I++H+E   AFV  +K+P L K  P +   +K VV +G 
Sbjct: 125 NAHGLYCVPLYDTLGAGAVEFIISHAEVSIAFVEEKKIPELFKTCPNSTKYMKTVVSFGG 184

Query: 583 GNEAAAKAAKDLXYVVHSFDELLALGAAKPAEPVPPKPDDLCTIMYTS 726
                 + A+ L  V+HS+DE L LG  K  E    KP D+CTIMYTS
Sbjct: 185 VKPEQKEEAEKLGLVIHSWDEFLKLGEGKQYELPIKKPSDICTIMYTS 232

>pir||T07929 probable long-chain-fatty-acid-CoA ligase (EC 6.2.1.3) isoform 2 -
           rape gi|1617270|emb|CAA64327.1| acyl-CoA synthetase
           [Brassica napus]
          Length = 667

 Score =  190 bits (483), Expect = 2e-47
 Identities = 92/228 (40%), Positives = 142/228 (61%), Gaps = 2/228 (0%)
 Frame = +1

Query: 49  KYLVEVEPARPANGDKPSASPVYRSVYAKDGFPTA--DFKTLFEMFEQSAAKYPDNQCLG 222
           K++ +VE  R  +  +PS  PVYRSV+AKDGFP       + +++F  S  KYP+N  LG
Sbjct: 7   KFIFQVEEGREGSDGRPSVGPVYRSVFAKDGFPEPIEGMDSCWDVFRMSVEKYPNNPMLG 66

Query: 223 KRVKKENGEAGPYVFKSYKEIHTEVANVASALRALGVNPAQRVGVFGANCPEWMVAMQAC 402
           +R +  +G+ G YV+++Y+E++  V  + ++LR+ GV    + G++GAN PEW+++M+AC
Sbjct: 67  RR-EIVDGKPGKYVWQTYQEVYDIVIKLGNSLRSCGVEEQAKCGIYGANSPEWIISMEAC 125

Query: 403 NRMAMHCVPLYDSLGENAIEYIVNHSEAVAAFVSSEKLPALAKALPKTKATLKVVVYWGA 582
           N   ++CVPLYD+LG  A+E+I+ HSE    FV  +K+  L K  PK    +K VV +G 
Sbjct: 126 NAHGLYCVPLYDTLGAGAVEFIITHSEVSIVFVEEKKISELFKTCPKATEYMKTVVSFGG 185

Query: 583 GNEAAAKAAKDLXYVVHSFDELLALGAAKPAEPVPPKPDDLCTIMYTS 726
                 +AA+    V++++DE L LG  K  +    K  D+CTIMYTS
Sbjct: 186 VTREQKEAAETFGLVIYAWDEFLKLGEGKQFDLPIKKKSDICTIMYTS 233

>ref|NP_194116.1| long-chain-fatty-acid--CoA ligase (acyl-CoA synthetase)
           [Arabidopsis thaliana] gi|7437843|pir||T08904 probable
           long-chain-fatty-acid-CoA ligase (EC 6.2.1.3) T32A16.20
           - Arabidopsis thaliana gi|4972089|emb|CAB43885.1|
           acyl-CoA synthetase-like protein [Arabidopsis thaliana]
           gi|7269234|emb|CAB81303.1| acyl-CoA synthetase-like
           protein [Arabidopsis thaliana]
           gi|15146196|gb|AAK83581.1| AT4g23850/T32A16_20
           [Arabidopsis thaliana]
           gi|20805869|gb|AAM28871.1|AF503754_1 long chain acyl-CoA
           synthetase 4 [Arabidopsis thaliana]
          Length = 666

 Score =  189 bits (479), Expect = 5e-47
 Identities = 89/228 (39%), Positives = 145/228 (63%), Gaps = 2/228 (0%)
 Frame = +1

Query: 49  KYLVEVEPARPANGDKPSASPVYRSVYAKDGFPTA--DFKTLFEMFEQSAAKYPDNQCLG 222
           KY+ +VE  +  +  +PS  PVYRS++AKDGFP       + +++F  S  KYP+N  LG
Sbjct: 6   KYIFQVEEGKEGSDGRPSVGPVYRSIFAKDGFPDPIEGMDSCWDVFRMSVEKYPNNPMLG 65

Query: 223 KRVKKENGEAGPYVFKSYKEIHTEVANVASALRALGVNPAQRVGVFGANCPEWMVAMQAC 402
           +R +  +G+ G YV+++Y+E++  V  + ++LR++GV    + G++GAN PEW+++M+AC
Sbjct: 66  RR-EIVDGKPGKYVWQTYQEVYDIVMKLGNSLRSVGVKDEAKCGIYGANSPEWIISMEAC 124

Query: 403 NRMAMHCVPLYDSLGENAIEYIVNHSEAVAAFVSSEKLPALAKALPKTKATLKVVVYWGA 582
           N   ++CVPLYD+LG +A+E+I++HSE    FV  +K+  L K  P +   +K VV +G 
Sbjct: 125 NAHGLYCVPLYDTLGADAVEFIISHSEVSIVFVEEKKISELFKTCPNSTEYMKTVVSFGG 184

Query: 583 GNEAAAKAAKDLXYVVHSFDELLALGAAKPAEPVPPKPDDLCTIMYTS 726
            +    + A+    V++++DE L LG  K  +    K  D+CTIMYTS
Sbjct: 185 VSREQKEEAETFGLVIYAWDEFLKLGEGKQYDLPIKKKSDICTIMYTS 232

>ref|NP_176622.1| long-chain-fatty-acid--CoA ligase (acyl-CoA synthetase), putative
           [Arabidopsis thaliana] gi|25293394|pir||B96668 probable
           acyl-CoA synthetase F15H21.7 [imported] - Arabidopsis
           thaliana gi|12323480|gb|AAG51719.1|AC066689_18 acyl-CoA
           synthetase, putative; 23993-27872 [Arabidopsis thaliana]
           gi|14532622|gb|AAK64039.1| putative acyl-CoA synthetase
           [Arabidopsis thaliana] gi|19310629|gb|AAL85045.1|
           putative acyl-CoA synthetase [Arabidopsis thaliana]
           gi|20805867|gb|AAM28870.1|AF503753_1 long chain acyl-CoA
           synthetase 3 [Arabidopsis thaliana]
          Length = 665

 Score =  188 bits (478), Expect = 6e-47
 Identities = 95/232 (40%), Positives = 143/232 (60%), Gaps = 3/232 (1%)
 Frame = +1

Query: 40  ASYKYLVEVEPARPA-NGDKPSASPVYRSVYAKDGFPTA--DFKTLFEMFEQSAAKYPDN 210
           A+ +Y+VEVE  +   +G  PS  PVYRS+YAKDGFP    D  + +++F  S  K P+N
Sbjct: 2   ATGRYIVEVEKGKQGVDGGSPSVGPVYRSIYAKDGFPEPPDDLVSAWDIFRLSVEKSPNN 61

Query: 211 QCLGKRVKKENGEAGPYVFKSYKEIHTEVANVASALRALGVNPAQRVGVFGANCPEWMVA 390
             LG+R +  +G+AG YV+++YKE+H  V  + +++R +GV    + G++GAN PEW+++
Sbjct: 62  PMLGRR-EIVDGKAGKYVWQTYKEVHNVVIKLGNSIRTIGVGKGDKCGIYGANSPEWIIS 120

Query: 391 MQACNRMAMHCVPLYDSLGENAIEYIVNHSEAVAAFVSSEKLPALAKALPKTKATLKVVV 570
           M+ACN   ++CVPLYD+LG  AIE+I+ H+E   AF    K+  L K  PK+   LK +V
Sbjct: 121 MEACNAHGLYCVPLYDTLGAGAIEFIICHAEVSLAFAEENKISELLKTAPKSTKYLKYIV 180

Query: 571 YWGAGNEAAAKAAKDLXYVVHSFDELLALGAAKPAEPVPPKPDDLCTIMYTS 726
            +G         A+     ++S+D+ L LG  K  E    +  D+CTIMYTS
Sbjct: 181 SFGEVTNNQRVEAERHRLTIYSWDQFLKLGEGKHYELPEKRRSDVCTIMYTS 232



EST assemble image


clone accession position
1 LCL024f11_r AV627304 1 385
2 LCL066g04_r AV629819 2 296
3 HCL041h09_r AV641889 5 218
4 LCL080e05_r AV630544 6 469
5 LCL090d07_r AV631217 6 393
6 CL17h06_r AV394149 12 485
7 CL21a11_r AV394367 12 536
8 LCL024g05_r AV627309 23 342
9 LCL055d11_r AV629258 137 582
10 LCL081a01_r AV630575 159 530
11 LCL041c04_r AV628402 162 468
12 LCL061g10_r AV629603 253 727




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research