KCC000300A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000300A_C01 KCC000300A_c01
tcataccaaccagCTTGCGCAACGACAACGTGTAACTACACTTCCAAAGCAAATGACTTG
CGCGTGACAATCCTTGGTCGCAAAGCACGATGGCGTCCACGCCTAAAGGAACCTCAAGAG
GAAATGGATCCTATGGAACATTTCGACCGCAAACAGCCCCTCCTTCGCGAACCAAGGCGG
AACCCTTGATTGATGACCCGCGCCATGCGGAGGACACACCCATGCCATGGCTGCGTTACT
TCTTTCCCAAGGACTTTGACCTGCGAGAGGGCCAGCCCGTGCAGCCCTACTACCAGTTCT
TTGATGTGGTGCAGCAGCCGCTACAGGAGGACACGTCCGTGCCGCCGCCTGACTGGGCAC
CAAACGCCTACTTCCAGCTCAGCTTCACGCAGGTGCATGTGCCCAAGGACATGGTTCTCG
CCACGCGCATCCCGCGGCCGCCGCCGCCACCGGACGGCTCCATTGATGTGACGGCCGACA
ACTCGAACATCCTCAAACCCGGGAATGAGAAGCTCATGGCTGACATCCTGGCCTTTTGCC
GCAGCGTGGCCACCTTCCGTGCTCGCACGTGGAAGGACGCGTTGCCGCTGGTGGACCTGC
TGCGGGGCGTGCTGGCGCACTTGCTCAACCACTACACCTGGGGCGCGGCG


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000300A_C01 KCC000300A_c01
         (650 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

gb|AAC82365.1| unknown [Myxococcus xanthus]                            45  0.001
gb|AAQ18030.1| integrase [Agrobacterium tumefaciens]                   42  0.006
ref|NP_524775.1| sticky ch1 CG17100-PA [Drosophila melanogaster]...    42  0.008
gb|AAM50242.1| LD15411p [Drosophila melanogaster]                      42  0.008
gb|AAF24476.1|AF203477_1 Sticky ch1 [Drosophila melanogaster]          42  0.008

>gb|AAC82365.1| unknown [Myxococcus xanthus]
          Length = 542

 Score = 44.7 bits (104), Expect = 0.001
 Identities = 52/165 (31%), Positives = 64/165 (38%), Gaps = 22/165 (13%)
 Frame = -3

Query: 642 PRCSG*ASAPARPAAGPPAATR-PSTCEHGRWP--RCGKRPGCQP*ASHSRV*GCSSCRP 472
           PRC    SAPA P+AG    T  PS+C  G  P  RCG  PG  P   H       S  P
Sbjct: 126 PRCRARPSAPA-PSAGRTCPTAGPSSCASGCCPTGRCGSAPGPTP---HGAEPSPPSQSP 181

Query: 471 S----------HQWSRPVAAAAAGCAWREPCPWAHAPA*S*AG-SRRLVPSQAAARTCPP 325
           S              RP  A+AAG       P          G +R   PS +A+   PP
Sbjct: 182 SPAPASSGGRRRTHPRPARASAAGATAPACLPPPRCCGRPGTGCARTAPPSTSASHPPPP 241

Query: 324 VAAAAPHQRTGSRAARAGPLA--------GQSPWERSNAAMAWVC 214
            +   P + +GS AA   P +        G +P  R+ A  A  C
Sbjct: 242 RSPGTPPRASGSPAAAPAPPSPACRPPPPGTTPAPRNAALPALPC 286

>gb|AAQ18030.1| integrase [Agrobacterium tumefaciens]
          Length = 459

 Score = 42.4 bits (98), Expect = 0.006
 Identities = 26/64 (40%), Positives = 29/64 (44%), Gaps = 5/64 (7%)
 Frame = +1

Query: 277 PCSPTTSSLMWCSSRYRRT-----RPCRRLTGHQTPTSSSASRRCMCPRTWFSPRASRGR 441
           P S  T + +  S RY R      R    L GH+ P    A  RC CPR W  P   RGR
Sbjct: 283 PYSDQTKARLRRSFRYIREDFFLGRSLHNLDGHEHPPHHLARHRCQCPRAWHDP--ERGR 340

Query: 442 RRHR 453
           RR R
Sbjct: 341 RRLR 344

>ref|NP_524775.1| sticky ch1 CG17100-PA [Drosophila melanogaster]
           gi|23170909|gb|AAF54527.2| CG17100-PA [Drosophila
           melanogaster]
          Length = 698

 Score = 42.0 bits (97), Expect = 0.008
 Identities = 39/106 (36%), Positives = 47/106 (43%), Gaps = 4/106 (3%)
 Frame = -3

Query: 465 QWSRPVAAAAAGCAWREPCPWAHAPA*S*AGSRRLVPSQAAART--CPPVAAAAPHQRTG 292
           Q S+  AAAAA  A         +PA S AG    VP      T   PP A   P   TG
Sbjct: 235 QRSQQAAAAAAVAAAAVAVANGSSPA-SNAGVDSKVPLTNGGGTGGAPPAADNVPSNSTG 293

Query: 291 S--RAARAGPLAGQSPWERSNAAMAWVCPPHGAGHQSRVPPWFAKE 160
           S   AA AG  +  S    SNAA + +CPP G    ++V P  A +
Sbjct: 294 SGSAAACAGGNSNSSGSNSSNAASSTICPPAGGSCPAKVTPLAAHQ 339

>gb|AAM50242.1| LD15411p [Drosophila melanogaster]
          Length = 621

 Score = 42.0 bits (97), Expect = 0.008
 Identities = 39/106 (36%), Positives = 47/106 (43%), Gaps = 4/106 (3%)
 Frame = -3

Query: 465 QWSRPVAAAAAGCAWREPCPWAHAPA*S*AGSRRLVPSQAAART--CPPVAAAAPHQRTG 292
           Q S+  AAAAA  A         +PA S AG    VP      T   PP A   P   TG
Sbjct: 158 QRSQQAAAAAAVAAAAVAVANGSSPA-SNAGVDSKVPLTNGGGTGGAPPAADNVPSNSTG 216

Query: 291 S--RAARAGPLAGQSPWERSNAAMAWVCPPHGAGHQSRVPPWFAKE 160
           S   AA AG  +  S    SNAA + +CPP G    ++V P  A +
Sbjct: 217 SGSAAACAGGNSNSSGSNSSNAASSTICPPAGGSCPAKVTPLAAHQ 262

>gb|AAF24476.1|AF203477_1 Sticky ch1 [Drosophila melanogaster]
          Length = 610

 Score = 42.0 bits (97), Expect = 0.008
 Identities = 39/106 (36%), Positives = 47/106 (43%), Gaps = 4/106 (3%)
 Frame = -3

Query: 465 QWSRPVAAAAAGCAWREPCPWAHAPA*S*AGSRRLVPSQAAART--CPPVAAAAPHQRTG 292
           Q S+  AAAAA  A         +PA S AG    VP      T   PP A   P   TG
Sbjct: 235 QRSQQAAAAAAVAAAAVAVANGSSPA-SNAGVDSKVPLTNGGGTGGAPPAADNVPSNSTG 293

Query: 291 S--RAARAGPLAGQSPWERSNAAMAWVCPPHGAGHQSRVPPWFAKE 160
           S   AA AG  +  S    SNAA + +CPP G    ++V P  A +
Sbjct: 294 SGSAAACAGGNSNSSGSNSSNAASSTICPPAGGSCPAKVTPLAAHQ 339



EST assemble image


clone accession position
1 MXL072f12_r BP097263 1 369
2 HCL027c07_r AV641073 14 494
3 CL17g01_r AV394105 189 650




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research