KCC000299A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000299A_C01 KCC000299A_c01
ctggacttggtctatcctgcatgcgccgccgccgccgcatcagccgcctcagccgcctca
ggcacagcaaaacagccgtgGCCACGCCTGCGACAAGCCTGGGGCTGGGTGTCGGCAGCA
GCCGCGTCGTGATGGACACCGGGCCGGGACAGAGAGGCTGGAGGCAGACGTCGCAGGTGA
GATGGAGGCGCGGGCGGCTCGTGACCTGGCGCTGCTGCCGCAGCTACAGCCGGCGCTGCT
GGGTGTGGGCCACACTGGAGCGACTGGGGCTGGGGGAGCAGCTGGAGGCAGCGCTTGCTG
ACGTGGCGGCTGTGGATGCTGGGGCCGGCGGCGGCACTGTCCGGGCGCACGGCGGCAGCG
GCCGTGGGCTGGGACTTGGCGGCGCTCTGGCAGGCGGCCGGGATTGCTACGACTGGGTCA
TTCCTGAGGTTGAAGAGGAGCCTGAGGGCGCGGCGGCTTGGGGCGCGTGCGAAGGGGGCA
CCTGTTCTGGCGGTTGGAATGAAGACAGCAATGGCGGCATGGGTGTCAGCCCTTGCGGGC
CGCGCCGCCGCGGGCCGTTGCATCTGGAGGCGACGGCGATCGCCACGGAGGCGTTGTGTC
GGCTGCTGCGCGGGGACTGCGGGCCGCCTCCCAGCCCTGTGCTGCTGAAGCACGTCGCGC
CACTGGACTCGGTGTATGACATCCTG


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000299A_C01 KCC000299A_c01
         (686 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

gb|AAG45421.1|AF309495_1 gamete-specific hydroxyproline-rich gly...    59  2e-10
sp|Q9FPQ6|GP1_CHLRE Vegetative cell wall protein gp1 precursor (...    63  2e-10
pir||S22697 extensin - Volvox carteri (fragment) gi|21992|emb|CA...    57  2e-10
ref|XP_046305.3| similar to KIAA1205 protein [Homo sapiens]            54  9e-09
dbj|BAA86519.1| KIAA1205 protein [Homo sapiens]                        54  9e-09

>gb|AAG45421.1|AF309495_1 gamete-specific hydroxyproline-rich glycoprotein a2 [Chlamydomonas
           reinhardtii]
          Length = 386

 Score = 58.5 bits (140), Expect(2) = 2e-10
 Identities = 46/121 (38%), Positives = 57/121 (47%), Gaps = 8/121 (6%)
 Frame = -2

Query: 586 VAIAVASRCNGPRRRGPQGLTPMPPLLSSFQ---PPEQVPPSHAPQAAAPSGSSSTSGMT 416
           +A+  AS  +    +     +PMPP  SS     PP  +PPS AP + AP      S + 
Sbjct: 113 IALLQASPADNVYLKSLSPPSPMPPKPSSPPSPTPPSPMPPSPAPPSPAPPSPLPPSPVP 172

Query: 415 QS*QSRPPARAPPSPS-PRPLPPCAR---TVPP-PAPASTAATSASAASSCSPSPSRSSV 251
            S    PP+ APPSP+ P P PP  R    VPP PAP S    S +  S   PSP   S 
Sbjct: 173 PS--PAPPSPAPPSPAPPSPAPPSPRPPSPVPPSPAPPSPLPPSPAPPSPAPPSPEPPSP 230

Query: 250 A 248
           A
Sbjct: 231 A 231

 Score = 58.5 bits (140), Expect = 9e-08
 Identities = 42/103 (40%), Positives = 49/103 (46%), Gaps = 1/103 (0%)
 Frame = -2

Query: 553 PRRRGPQGLTPMPPLLSSFQPPEQVPPSHAPQAAAPSGSSSTSGMTQS*QSRPPARAPPS 374
           P    P   +P PP   S  PP  VPPS AP + AP   +  S    S   RPP+  PPS
Sbjct: 150 PMPPSPAPPSPAPP---SPLPPSPVPPSPAPPSPAPPSPAPPSPAPPS--PRPPSPVPPS 204

Query: 373 PS-PRPLPPCARTVPPPAPASTAATSASAASSCSPSPSRSSVA 248
           P+ P PLPP +   P PAP S    S +  S   PSP   S A
Sbjct: 205 PAPPSPLPP-SPAPPSPAPPSPEPPSPAPPSPEPPSPEPPSPA 246

 Score = 56.2 bits (134), Expect = 4e-07
 Identities = 36/99 (36%), Positives = 45/99 (45%), Gaps = 3/99 (3%)
 Frame = -2

Query: 553 PRRRGPQGLTPMPPLLSSFQPPEQVPPSHAPQAAAPSGSSSTSGMTQS*QS---RPPARA 383
           P    P+  +P+PP   S  PP  +PPS AP + AP      S    S +     PP+ A
Sbjct: 190 PAPPSPRPPSPVPP---SPAPPSPLPPSPAPPSPAPPSPEPPSPAPPSPEPPSPEPPSPA 246

Query: 382 PPSPSPRPLPPCARTVPPPAPASTAATSASAASSCSPSP 266
           PPSP P    P +   P PAP S    S +  S   PSP
Sbjct: 247 PPSPEPPSPEPPSPAPPSPAPPSPVPPSPAPPSPVPPSP 285

 Score = 55.1 bits (131), Expect = 1e-06
 Identities = 36/102 (35%), Positives = 42/102 (40%)
 Frame = -2

Query: 553 PRRRGPQGLTPMPPLLSSFQPPEQVPPSHAPQAAAPSGSSSTSGMTQS*QSRPPARAPPS 374
           P    P    P  P   S +PP  VPPS AP +  P   +  S    S    PP+ APPS
Sbjct: 177 PPSPAPPSPAPPSPAPPSPRPPSPVPPSPAPPSPLPPSPAPPSPAPPS--PEPPSPAPPS 234

Query: 373 PSPRPLPPCARTVPPPAPASTAATSASAASSCSPSPSRSSVA 248
           P P    P +   P P P S    S +  S   PSP   S A
Sbjct: 235 PEPPSPEPPSPAPPSPEPPSPEPPSPAPPSPAPPSPVPPSPA 276

 Score = 53.1 bits (126), Expect = 4e-06
 Identities = 37/101 (36%), Positives = 41/101 (39%), Gaps = 4/101 (3%)
 Frame = -2

Query: 553 PRRRGPQGLTPMP----PLLSSFQPPEQVPPSHAPQAAAPSGSSSTSGMTQS*QSRPPAR 386
           P  R P  + P P    PL  S  PP   PPS  P + AP      S    S    PP+ 
Sbjct: 193 PSPRPPSPVPPSPAPPSPLPPSPAPPSPAPPSPEPPSPAPPSPEPPSPEPPS--PAPPSP 250

Query: 385 APPSPSPRPLPPCARTVPPPAPASTAATSASAASSCSPSPS 263
            PPSP P    P +   P P P S A  S    S   PSPS
Sbjct: 251 EPPSPEPPSPAPPSPAPPSPVPPSPAPPSPVPPSPPPPSPS 291

 Score = 52.4 bits (124), Expect = 6e-06
 Identities = 39/128 (30%), Positives = 49/128 (37%), Gaps = 3/128 (2%)
 Frame = -2

Query: 622 PQSPRSSRHNASVAIAVASRCNGPRRRGPQGLTPMPPLLSSFQPPEQVPPSHAPQAAAPS 443
           P  P+ S   +    +       P    P    P  P+  S  PP   PPS AP + AP 
Sbjct: 134 PMPPKPSSPPSPTPPSPMPPSPAPPSPAPPSPLPPSPVPPSPAPPSPAPPSPAPPSPAPP 193

Query: 442 GSSSTSGMTQS*---QSRPPARAPPSPSPRPLPPCARTVPPPAPASTAATSASAASSCSP 272
                S +  S       PP+ APPSP+P    P +   P P P S    S +  S   P
Sbjct: 194 SPRPPSPVPPSPAPPSPLPPSPAPPSPAPPSPEPPSPAPPSPEPPSPEPPSPAPPSPEPP 253

Query: 271 SPSRSSVA 248
           SP   S A
Sbjct: 254 SPEPPSPA 261

 Score = 52.0 bits (123), Expect = 8e-06
 Identities = 34/97 (35%), Positives = 40/97 (41%)
 Frame = -2

Query: 538 PQGLTPMPPLLSSFQPPEQVPPSHAPQAAAPSGSSSTSGMTQS*QSRPPARAPPSPSPRP 359
           P    P  P   S  PP   PPS  P +  P   +  S +  S    PP+ APPSP P  
Sbjct: 172 PPSPAPPSPAPPSPAPPSPAPPSPRPPSPVPPSPAPPSPLPPS--PAPPSPAPPSPEPPS 229

Query: 358 LPPCARTVPPPAPASTAATSASAASSCSPSPSRSSVA 248
             P +   P P P S A  S    S   PSP+  S A
Sbjct: 230 PAPPSPEPPSPEPPSPAPPSPEPPSPEPPSPAPPSPA 266

 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 35/100 (35%), Positives = 42/100 (42%)
 Frame = -2

Query: 553 PRRRGPQGLTPMPPLLSSFQPPEQVPPSHAPQAAAPSGSSSTSGMTQS*QSRPPARAPPS 374
           P    P   +P PP   S  PP   PPS  P + AP   +  S    S    PP+  PPS
Sbjct: 185 PAPPSPAPPSPRPP---SPVPPSPAPPSPLPPSPAPPSPAPPSPEPPS--PAPPSPEPPS 239

Query: 373 PSPRPLPPCARTVPPPAPASTAATSASAASSCSPSPSRSS 254
           P P    P +   P P P S A  S +  S   PSP+  S
Sbjct: 240 PEPPSPAPPSPEPPSPEPPSPAPPSPAPPSPVPPSPAPPS 279

 Score = 47.8 bits (112), Expect = 2e-04
 Identities = 34/104 (32%), Positives = 43/104 (40%)
 Frame = -2

Query: 553 PRRRGPQGLTPMPPLLSSFQPPEQVPPSHAPQAAAPSGSSSTSGMTQS*QSRPPARAPPS 374
           P    P+  +P PP   S +PP   PPS AP + AP                PP+ APPS
Sbjct: 235 PEPPSPEPPSPAPP---SPEPPSPEPPSPAPPSPAPPSPV------------PPSPAPPS 279

Query: 373 PSPRPLPPCARTVPPPAPASTAATSASAASSCSPSPSRSSVAHT 242
           P P   PP + + P P   +   T     SS   +P   S A T
Sbjct: 280 PVPPSPPPPSPSPPTPIITNGQGTGQQQISSGGATPGPVSGAAT 323

 Score = 39.3 bits (90), Expect = 0.057
 Identities = 27/92 (29%), Positives = 32/92 (34%)
 Frame = -2

Query: 508 LSSFQPPEQVPPSHAPQAAAPSGSSSTSGMTQS*QSRPPARAPPSPSPRPLPPCARTVPP 329
           L S  PP  +PP                       S PP+  PPSP P    P +   P 
Sbjct: 126 LKSLSPPSPMPPK---------------------PSSPPSPTPPSPMPPSPAPPSPAPPS 164

Query: 328 PAPASTAATSASAASSCSPSPSRSSVAHTQQR 233
           P P S    S +  S   PSP+  S A    R
Sbjct: 165 PLPPSPVPPSPAPPSPAPPSPAPPSPAPPSPR 196

 Score = 37.0 bits (84), Expect = 0.28
 Identities = 45/163 (27%), Positives = 56/163 (33%), Gaps = 1/163 (0%)
 Frame = -3

Query: 618 SPRAAADTTPPWRSPSPPDATARGGAARKG*HPCRHCCLHSNRQNRCPLRTRPKPPRPQA 439
           SP     ++PP  SP+PP       A      P     L  +     P    P PP P A
Sbjct: 133 SPMPPKPSSPP--SPTPPSPMPPSPAPPS---PAPPSPLPPSPVPPSPAPPSPAPPSP-A 186

Query: 438 PLQPQE*PSRSNPGRLPERRQVPAHGRCRRAPGQCRRRPQHPQPPRQQALPPAAP-PAPV 262
           P  P   PS   P  +P     P+      +P      P  P+PP      P  P P P 
Sbjct: 187 PPSPAP-PSPRPPSPVPPSPAPPSP--LPPSPAPPSPAPPSPEPPSPAPPSPEPPSPEPP 243

Query: 261 APVWPTPSSAGCSCGSSARSRAARASISPATSASSLSVPARCP 133
           +P  P+P        S A    A  S  P + A    VP   P
Sbjct: 244 SPAPPSPEPPSPEPPSPAPPSPAPPSPVPPSPAPPSPVPPSPP 286

 Score = 34.7 bits (78), Expect = 1.4
 Identities = 41/177 (23%), Positives = 58/177 (32%)
 Frame = -3

Query: 672 PSPVARRASAAQGWEAARSPRAAADTTPPWRSPSPPDATARGGAARKG*HPCRHCCLHSN 493
           PSPV    +       + +P + A  +P   SP+PP                        
Sbjct: 198 PSPVPPSPAPPSPLPPSPAPPSPAPPSPEPPSPAPPS----------------------- 234

Query: 492 RQNRCPLRTRPKPPRPQAPLQPQE*PSRSNPGRLPERRQVPAHGRCRRAPGQCRRRPQHP 313
                P    P+PP P AP  P E PS   P   P              P      P  P
Sbjct: 235 -----PEPPSPEPPSP-APPSP-EPPSPEPPSPAP--------------PSPAPPSPVPP 273

Query: 312 QPPRQQALPPAAPPAPVAPVWPTPSSAGCSCGSSARSRAARASISPATSASSLSVPA 142
            P     +PP+ PP   +P  PTP           +  +  A+  P + A++L+  A
Sbjct: 274 SPAPPSPVPPSPPPPSPSP--PTPIITNGQGTGQQQISSGGATPGPVSGAATLTTSA 328

 Score = 28.9 bits (63), Expect(2) = 2e-10
 Identities = 18/47 (38%), Positives = 22/47 (46%), Gaps = 2/47 (4%)
 Frame = -1

Query: 275 PQPQSLQCGPHPAAPAVAAAAAPGHEP--PAPPSHLRRLPPASLSRP 141
           P+P S    P P +PA  + A P   P  PAPPS +   PP     P
Sbjct: 250 PEPPS----PEPPSPAPPSPAPPSPVPPSPAPPSPVPPSPPPPSPSP 292

>sp|Q9FPQ6|GP1_CHLRE Vegetative cell wall protein gp1 precursor (Hydroxyproline-rich
           glycoprotein 1) gi|12018147|gb|AAG45420.1|AF309494_1
           vegetative cell wall protein gp1 [Chlamydomonas
           reinhardtii]
          Length = 555

 Score = 63.2 bits (152), Expect = 4e-09
 Identities = 39/97 (40%), Positives = 49/97 (50%)
 Frame = -2

Query: 538 PQGLTPMPPLLSSFQPPEQVPPSHAPQAAAPSGSSSTSGMTQS*QSRPPARAPPSPSPRP 359
           P    P PP   S  PP  VPPS AP   +P+  S          S PP+ APP+PSP P
Sbjct: 295 PSPAPPTPPTPPSPSPPSPVPPSPAPVPPSPAPPSPA-------PSPPPSPAPPTPSPSP 347

Query: 358 LPPCARTVPPPAPASTAATSASAASSCSPSPSRSSVA 248
            P  + + P P+P+ + + S S   S SP PS S VA
Sbjct: 348 SPSPSPS-PSPSPSPSPSPSPSPIPSPSPKPSPSPVA 383

 Score = 62.4 bits (150), Expect = 6e-09
 Identities = 36/92 (39%), Positives = 45/92 (48%)
 Frame = -2

Query: 526 TPMPPLLSSFQPPEQVPPSHAPQAAAPSGSSSTSGMTQS*QSRPPARAPPSPSPRPLPPC 347
           TPMPP      PP   P    P    P   S  S +  S    PP+ APPSP+P P P  
Sbjct: 284 TPMPP-----SPPSPPPSPAPPTPPTPPSPSPPSPVPPSPAPVPPSPAPPSPAPSPPPSP 338

Query: 346 ARTVPPPAPASTAATSASAASSCSPSPSRSSV 251
           A   P P+P+ + + S S + S SPSPS S +
Sbjct: 339 APPTPSPSPSPSPSPSPSPSPSPSPSPSPSPI 370

 Score = 59.7 bits (143), Expect = 4e-08
 Identities = 43/140 (30%), Positives = 56/140 (39%)
 Frame = -2

Query: 682 MSYTESSGATCFSSTGLGGGPQSPRSSRHNASVAIAVASRCNGPRRRGPQGLTPMPPLLS 503
           +++  S+ A C    G+   P SP             +     P    P   +P PP   
Sbjct: 21  LAFVASANAQCVPG-GIFNCPPSPAPPSPAPPSPAPPSPAPPSPAPPSPGPPSPAPPSPP 79

Query: 502 SFQPPEQVPPSHAPQAAAPSGSSSTSGMTQS*QSRPPARAPPSPSPRPLPPCARTVPPPA 323
           S  PP   PPS AP + AP   +  S    S    PP+ APPSP P P PP      PP+
Sbjct: 80  SPAPPSPAPPSPAPPSPAPPSPAPPSPAPPS--PAPPSPAPPSP-PSPAPPSPSPPAPPS 136

Query: 322 PASTAATSASAASSCSPSPS 263
           P+  +       S   PSPS
Sbjct: 137 PSPPSPAPPLPPSPAPPSPS 156

 Score = 58.2 bits (139), Expect(2) = 2e-10
 Identities = 38/103 (36%), Positives = 49/103 (46%), Gaps = 1/103 (0%)
 Frame = -2

Query: 553 PRRRGPQGLTPMPPLLSSFQPPEQVPPSHAPQA-AAPSGSSSTSGMTQS*QSRPPARAPP 377
           P    P   +P PP  +   PP   PPS +P A  +PS  S    +       PP+ APP
Sbjct: 101 PAPPSPAPPSPAPPSPAPPSPPSPAPPSPSPPAPPSPSPPSPAPPL-------PPSPAPP 153

Query: 376 SPSPRPLPPCARTVPPPAPASTAATSASAASSCSPSPSRSSVA 248
           SPSP P+PP      PP+PA  + T  S +    PSP+  S A
Sbjct: 154 SPSP-PVPPSPSPPVPPSPAPPSPTPPSPSPPVPPSPAPPSPA 195

 Score = 56.6 bits (135), Expect = 3e-07
 Identities = 37/92 (40%), Positives = 44/92 (47%), Gaps = 1/92 (1%)
 Frame = -2

Query: 526 TPMPPLLSSFQPPEQVPPSHAPQAAAPSGSSSTSGMTQS*QS-RPPARAPPSPSPRPLPP 350
           +P PP   S  PP   PPS AP + AP      S    S  S  PP+ APPSP+P    P
Sbjct: 42  SPAPP---SPAPPSPAPPSPAPPSPAPPSPGPPSPAPPSPPSPAPPSPAPPSPAPPSPAP 98

Query: 349 CARTVPPPAPASTAATSASAASSCSPSPSRSS 254
            +   P PAP S A  S +  S  SP+P   S
Sbjct: 99  PSPAPPSPAPPSPAPPSPAPPSPPSPAPPSPS 130

 Score = 56.2 bits (134), Expect = 4e-07
 Identities = 38/97 (39%), Positives = 42/97 (43%), Gaps = 1/97 (1%)
 Frame = -2

Query: 553 PRRRGPQGLTPMPPLLSSFQPPEQVPPSHAPQAAAPSGSSSTSGMTQS*QSRPPARAPPS 374
           P    P    P  P   S  PP   PPS AP + AP   +  S    S    PP+ APPS
Sbjct: 73  PAPPSPPSPAPPSPAPPSPAPPSPAPPSPAPPSPAPPSPAPPSPAPPS----PPSPAPPS 128

Query: 373 PS-PRPLPPCARTVPPPAPASTAATSASAASSCSPSP 266
           PS P P  P   +  PP P S A  S S     SPSP
Sbjct: 129 PSPPAPPSPSPPSPAPPLPPSPAPPSPSPPVPPSPSP 165

 Score = 55.5 bits (132), Expect = 8e-07
 Identities = 39/97 (40%), Positives = 46/97 (47%)
 Frame = -2

Query: 538 PQGLTPMPPLLSSFQPPEQVPPSHAPQAAAPSGSSSTSGMTQS*QSRPPARAPPSPSPRP 359
           P G+   PP   S  PP   PPS AP + AP   +  S         PP+ APPSP P P
Sbjct: 33  PGGIFNCPP---SPAPPSPAPPSPAPPSPAPPSPAPPS-------PGPPSPAPPSP-PSP 81

Query: 358 LPPCARTVPPPAPASTAATSASAASSCSPSPSRSSVA 248
            PP +   P PAP S A  S +  S   PSP+  S A
Sbjct: 82  APP-SPAPPSPAPPSPAPPSPAPPSPAPPSPAPPSPA 117

 Score = 54.7 bits (130), Expect = 1e-06
 Identities = 36/100 (36%), Positives = 47/100 (47%)
 Frame = -2

Query: 553 PRRRGPQGLTPMPPLLSSFQPPEQVPPSHAPQAAAPSGSSSTSGMTQS*QSRPPARAPPS 374
           P    P   +P PP  +   P   VPPS AP + AP    S +  + +    PP+ APPS
Sbjct: 161 PSPSPPVPPSPAPPSPTPPSPSPPVPPSPAPPSPAPPVPPSPAPPSPA-PPVPPSPAPPS 219

Query: 373 PSPRPLPPCARTVPPPAPASTAATSASAASSCSPSPSRSS 254
           P P P PP   +  PP+P+  A  S    S   PSP+  S
Sbjct: 220 P-PSPAPPSPPSPAPPSPSPPAPPSPVPPSPAPPSPAPPS 258

 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 36/100 (36%), Positives = 48/100 (48%), Gaps = 4/100 (4%)
 Frame = -2

Query: 553 PRRRGPQGLTPMPPLLSSFQPPEQVPPSHAPQAAAPSGSSSTSGMTQS*QSR----PPAR 386
           P    P   +P PP+  S  PP  VPPS AP +  P   S     + +  S     PP+ 
Sbjct: 145 PLPPSPAPPSPSPPVPPSPSPP--VPPSPAPPSPTPPSPSPPVPPSPAPPSPAPPVPPSP 202

Query: 385 APPSPSPRPLPPCARTVPPPAPASTAATSASAASSCSPSP 266
           APPSP+P P+PP      PP+PA  +  S +  S   P+P
Sbjct: 203 APPSPAP-PVPPSPAPPSPPSPAPPSPPSPAPPSPSPPAP 241

 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 39/105 (37%), Positives = 44/105 (41%), Gaps = 5/105 (4%)
 Frame = -2

Query: 553 PRRRGPQGLTPMPPLLSSFQPPEQVPPSHAPQAAAPSGSSSTSGMTQS*QSRPPARAPPS 374
           P    P   +P PP  S   PP  VPPS AP + AP               +PPA  PP 
Sbjct: 221 PSPAPPSPPSPAPPSPSPPAPPSPVPPSPAPPSPAPPSP------------KPPA-PPPP 267

Query: 373 PSPRPLPP-----CARTVPPPAPASTAATSASAASSCSPSPSRSS 254
           PSP P PP      A T  PP+P S   + A       PSPS  S
Sbjct: 268 PSPPPPPPPRPPFPANTPMPPSPPSPPPSPAPPTPPTPPSPSPPS 312

 Score = 53.1 bits (126), Expect = 4e-06
 Identities = 36/96 (37%), Positives = 43/96 (44%)
 Frame = -2

Query: 553 PRRRGPQGLTPMPPLLSSFQPPEQVPPSHAPQAAAPSGSSSTSGMTQS*QSRPPARAPPS 374
           P    P    P+PP  +   P   VPPS AP + AP    S +         PP+ APPS
Sbjct: 174 PSPTPPSPSPPVPPSPAPPSPAPPVPPSPAPPSPAPPVPPSPA------PPSPPSPAPPS 227

Query: 373 PSPRPLPPCARTVPPPAPASTAATSASAASSCSPSP 266
           P P P PP   +  PPAP S    S +  S   PSP
Sbjct: 228 P-PSPAPP---SPSPPAPPSPVPPSPAPPSPAPPSP 259

 Score = 52.8 bits (125), Expect = 5e-06
 Identities = 35/109 (32%), Positives = 48/109 (43%), Gaps = 7/109 (6%)
 Frame = -2

Query: 553 PRRRGPQGLTPMPPLLSSFQPPEQVPPSHAPQAAAPSGSSSTSGMTQS*QSRPPARAPPS 374
           P    P    P+PP  S   PP   PPS  P + +P    S +  + +    PP+ APPS
Sbjct: 148 PSPAPPSPSPPVPPSPSPPVPPSPAPPSPTPPSPSPPVPPSPAPPSPA-PPVPPSPAPPS 206

Query: 373 PSPR-------PLPPCARTVPPPAPASTAATSASAASSCSPSPSRSSVA 248
           P+P        P PP      PP+PA  + +  +  S   PSP+  S A
Sbjct: 207 PAPPVPPSPAPPSPPSPAPPSPPSPAPPSPSPPAPPSPVPPSPAPPSPA 255

 Score = 52.4 bits (124), Expect = 6e-06
 Identities = 34/97 (35%), Positives = 42/97 (43%), Gaps = 1/97 (1%)
 Frame = -2

Query: 553 PRRRGPQGLTPMPPLLSSFQPPEQVPPSHAPQAAAPSGSSSTSGMTQS*QSRPPARAPPS 374
           P    P    P PP  S   P   +PPS AP + +P    S S         PP+ APPS
Sbjct: 122 PSPAPPSPSPPAPPSPSPPSPAPPLPPSPAPPSPSPPVPPSPSPPV------PPSPAPPS 175

Query: 373 PS-PRPLPPCARTVPPPAPASTAATSASAASSCSPSP 266
           P+ P P PP   +  PP+PA     S +  S   P P
Sbjct: 176 PTPPSPSPPVPPSPAPPSPAPPVPPSPAPPSPAPPVP 212

 Score = 51.6 bits (122), Expect = 1e-05
 Identities = 37/107 (34%), Positives = 47/107 (43%), Gaps = 7/107 (6%)
 Frame = -2

Query: 553 PRRRGPQGLTPMPPLLSSFQPPEQ---VPPSHAPQAAAPSGSSSTSGMTQS*QSRPPARA 383
           P    P   +P PPL  S  PP     VPPS +P         S +  + S    PP+ A
Sbjct: 132 PAPPSPSPPSPAPPLPPSPAPPSPSPPVPPSPSPPVPPSPAPPSPTPPSPS-PPVPPSPA 190

Query: 382 PPSPS----PRPLPPCARTVPPPAPASTAATSASAASSCSPSPSRSS 254
           PPSP+    P P PP      PP+PA  +  S +  S  SP+P   S
Sbjct: 191 PPSPAPPVPPSPAPPSPAPPVPPSPAPPSPPSPAPPSPPSPAPPSPS 237

 Score = 50.8 bits (120), Expect = 2e-05
 Identities = 39/108 (36%), Positives = 45/108 (41%), Gaps = 9/108 (8%)
 Frame = -2

Query: 553 PRRRGPQGLTPMPPLLSSFQPPEQVPPSHAPQAAAPSGSSSTSGMTQS*QSRPPARAPPS 374
           P    P+   P PP  S   PP   PP  A     PS  S            PP+ +PPS
Sbjct: 254 PAPPSPKPPAPPPPP-SPPPPPPPRPPFPANTPMPPSPPSPPPSPAPPTPPTPPSPSPPS 312

Query: 373 P--------SPRPLPPCARTVPPPAPA-STAATSASAASSCSPSPSRS 257
           P         P P PP     PPP+PA  T + S S + S SPSPS S
Sbjct: 313 PVPPSPAPVPPSPAPPSPAPSPPPSPAPPTPSPSPSPSPSPSPSPSPS 360

 Score = 48.1 bits (113), Expect = 1e-04
 Identities = 36/116 (31%), Positives = 43/116 (37%), Gaps = 12/116 (10%)
 Frame = -2

Query: 553 PRRRGPQGLTPMPPLLSSFQPPEQVPPSHAPQA------------AAPSGSSSTSGMTQS 410
           P    P    P+PP  +   P   VPPS AP +            A PS S         
Sbjct: 187 PSPAPPSPAPPVPPSPAPPSPAPPVPPSPAPPSPPSPAPPSPPSPAPPSPSPPAPPSPVP 246

Query: 409 *QSRPPARAPPSPSPRPLPPCARTVPPPAPASTAATSASAASSCSPSPSRSSVAHT 242
               PP+ APPSP P P PP   + PPP P      + +      PSP  S    T
Sbjct: 247 PSPAPPSPAPPSPKP-PAPPPPPSPPPPPPPRPPFPANTPMPPSPPSPPPSPAPPT 301

 Score = 47.4 bits (111), Expect = 2e-04
 Identities = 35/114 (30%), Positives = 44/114 (37%), Gaps = 12/114 (10%)
 Frame = -2

Query: 553 PRRRGPQGLTPMPPLLSSFQPPEQVPPSHAPQAAAPSGSSSTSGMTQS*QSRPPARAPPS 374
           P    P   +P PP  +   P    PPS AP + +P    S S  + +    PP+ APPS
Sbjct: 96  PAPPSPAPPSPAPPSPAPPSPAPPSPPSPAPPSPSPPAPPSPSPPSPA-PPLPPSPAPPS 154

Query: 373 PSP------------RPLPPCARTVPPPAPASTAATSASAASSCSPSPSRSSVA 248
           PSP             P PP      P  P   +    S A    PSP+  S A
Sbjct: 155 PSPPVPPSPSPPVPPSPAPPSPTPPSPSPPVPPSPAPPSPAPPVPPSPAPPSPA 208

 Score = 44.3 bits (103), Expect = 0.002
 Identities = 49/177 (27%), Positives = 66/177 (36%), Gaps = 11/177 (6%)
 Frame = -3

Query: 627 AARSPRAAADTTPPWRSPSPPDATARGGAARKG*HPCRHCCLHSNRQNRCPLRTRPKPPR 448
           A  SP + A  +PP  SP+PP  +           P     +  +     P    PKPP 
Sbjct: 216 APPSPPSPAPPSPP--SPAPPSPSP----------PAPPSPVPPSPAPPSPAPPSPKPPA 263

Query: 447 PQAPLQPQE*PSR-----SNPGRLPERRQVPAHGRCRRAPGQCRRRPQHPQPPRQQALPP 283
           P  P  P   P       +N    P     P        P      P  P PP    +PP
Sbjct: 264 PPPPPSPPPPPPPRPPFPANTPMPPSPPSPPPSPAPPTPPTPPSPSPPSPVPPSPAPVPP 323

Query: 282 A-APPAPV-----APVWPTPSSAGCSCGSSARSRAARASISPATSASSLSVPARCPS 130
           + APP+P      +P  PTPS +     S + S +   S SP+ S S +  P+  PS
Sbjct: 324 SPAPPSPAPSPPPSPAPPTPSPS--PSPSPSPSPSPSPSPSPSPSPSPIPSPSPKPS 378

 Score = 42.7 bits (99), Expect = 0.005
 Identities = 45/184 (24%), Positives = 61/184 (32%), Gaps = 4/184 (2%)
 Frame = -3

Query: 672 PSPVARRASAAQGWEAARSPRAAADTTPPWRSPSPPDATARGGAARKG*HPCRHCCLHSN 493
           PSP     +       + +P + A  +PP  SP+PP  +     +     P         
Sbjct: 94  PSPAPPSPAPPSPAPPSPAPPSPAPPSPP--SPAPPSPSPPAPPSPSPPSPAP------- 144

Query: 492 RQNRCPLRTRPKPPRPQAPLQPQE*P----SRSNPGRLPERRQVPAHGRCRRAPGQCRRR 325
                PL   P PP P  P+ P   P    S + P   P     P        P      
Sbjct: 145 -----PLPPSPAPPSPSPPVPPSPSPPVPPSPAPPSPTPPSPSPPV------PPSPAPPS 193

Query: 324 PQHPQPPRQQALPPAAPPAPVAPVWPTPSSAGCSCGSSARSRAARASISPATSASSLSVP 145
           P  P PP   A P  APP P +P  P+P S       S    +      P+    S + P
Sbjct: 194 PAPPVPP-SPAPPSPAPPVPPSPAPPSPPSPAPPSPPSPAPPSPSPPAPPSPVPPSPAPP 252

Query: 144 ARCP 133
           +  P
Sbjct: 253 SPAP 256

 Score = 41.6 bits (96), Expect = 0.011
 Identities = 33/105 (31%), Positives = 41/105 (38%)
 Frame = -2

Query: 622 PQSPRSSRHNASVAIAVASRCNGPRRRGPQGLTPMPPLLSSFQPPEQVPPSHAPQAAAPS 443
           P SP S   + +           P    P    P+PP  +   P    PPS AP   +PS
Sbjct: 287 PPSPPSPPPSPAPPTPPTPPSPSPPSPVPPSPAPVPPSPAPPSPAPSPPPSPAPPTPSPS 346

Query: 442 GSSSTSGMTQS*QSRPPARAPPSPSPRPLPPCARTVPPPAPASTA 308
            S S S       S  P+   PSPSP P P      P P+P+  A
Sbjct: 347 PSPSPSPSPSPSPSPSPS---PSPSPIPSPS-----PKPSPSPVA 383

 Score = 38.1 bits (87), Expect = 0.13
 Identities = 45/166 (27%), Positives = 56/166 (33%)
 Frame = -3

Query: 672 PSPVARRASAAQGWEAARSPRAAADTTPPWRSPSPPDATARGGAARKG*HPCRHCCLHSN 493
           PSPV    S A    A  SP+  A   PP  SP PP        A     P         
Sbjct: 242 PSPVP--PSPAPPSPAPPSPKPPAPPPPP--SPPPPPPPRPPFPANTPMPP--------- 288

Query: 492 RQNRCPLRTRPKPPRPQAPLQPQE*PSRSNPGRLPERRQVPAHGRCRRAPGQCRRRPQHP 313
                   + P PP   AP  P   PS S P  +P     P+      +P      P  P
Sbjct: 289 --------SPPSPPPSPAPPTPPTPPSPSPPSPVP-----PSPAPVPPSPAPPSPAPSPP 335

Query: 312 QPPRQQALPPAAPPAPVAPVWPTPSSAGCSCGSSARSRAARASISP 175
             P      P+  P+P     P+PS +     S   S + + S SP
Sbjct: 336 PSPAPPTPSPSPSPSPSPSPSPSPSPSPSPSPSPIPSPSPKPSPSP 381

 Score = 37.4 bits (85), Expect = 0.22
 Identities = 26/76 (34%), Positives = 33/76 (43%), Gaps = 1/76 (1%)
 Frame = -3

Query: 462 PKPPRPQAPLQPQE*P-SRSNPGRLPERRQVPAHGRCRRAPGQCRRRPQHPQPPRQQALP 286
           P PP P +P  P   P S + P   P     P+      AP      P  P PP   A P
Sbjct: 73  PAPPSPPSPAPPSPAPPSPAPPSPAPPSPAPPSPAPPSPAPPS----PAPPSPP-SPAPP 127

Query: 285 PAAPPAPVAPVWPTPS 238
             +PPAP +P  P+P+
Sbjct: 128 SPSPPAPPSPSPPSPA 143

 Score = 36.6 bits (83), Expect = 0.37
 Identities = 25/81 (30%), Positives = 30/81 (36%), Gaps = 1/81 (1%)
 Frame = -3

Query: 477 PLRTRPKPPRPQAPLQ-PQE*PSRSNPGRLPERRQVPAHGRCRRAPGQCRRRPQHPQPPR 301
           P    P PP P  P   P   PS + P   P     P+      AP         P  P 
Sbjct: 58  PAPPSPAPPSPGPPSPAPPSPPSPAPPSPAPPSPAPPSPAPPSPAPPSPAPPSPAPPSPA 117

Query: 300 QQALPPAAPPAPVAPVWPTPS 238
             + P  APP+P  P  P+PS
Sbjct: 118 PPSPPSPAPPSPSPPAPPSPS 138

 Score = 36.2 bits (82), Expect = 0.48
 Identities = 33/118 (27%), Positives = 39/118 (32%), Gaps = 1/118 (0%)
 Frame = -3

Query: 477 PLRTRPKPPRPQAPL-QPQE*PSRSNPGRLPERRQVPAHGRCRRAPGQCRRRPQHPQPPR 301
           P+   P PP P  P   P   PS + P   P     PA       P      P  P PP 
Sbjct: 166 PVPPSPAPPSPTPPSPSPPVPPSPAPPSPAPPVPPSPA------PPSPAPPVPPSPAPPS 219

Query: 300 QQALPPAAPPAPVAPVWPTPSSAGCSCGSSARSRAARASISPATSASSLSVPARCPSR 127
             +  P +PP+P  P    P+       S A    A  S  P       S P   P R
Sbjct: 220 PPSPAPPSPPSPAPPSPSPPAPPSPVPPSPAPPSPAPPSPKPPAPPPPPSPPPPPPPR 277

 Score = 33.5 bits (75), Expect = 3.1
 Identities = 29/113 (25%), Positives = 36/113 (31%), Gaps = 1/113 (0%)
 Frame = -3

Query: 480 CPLRTRPKPPRPQAPLQPQE*P-SRSNPGRLPERRQVPAHGRCRRAPGQCRRRPQHPQPP 304
           CP    P  P P +P  P   P S + P   P     P+       P      P  P P 
Sbjct: 39  CPPSPAPPSPAPPSPAPPSPAPPSPAPPSPGPPSPAPPS------PPSPAPPSPAPPSPA 92

Query: 303 RQQALPPAAPPAPVAPVWPTPSSAGCSCGSSARSRAARASISPATSASSLSVP 145
                PP+  P   AP  P P S       S    +      P+ S  S + P
Sbjct: 93  PPSPAPPSPAPPSPAPPSPAPPSPAPPSPPSPAPPSPSPPAPPSPSPPSPAPP 145

 Score = 32.3 bits (72), Expect = 6.9
 Identities = 21/65 (32%), Positives = 28/65 (42%)
 Frame = -3

Query: 324 PQHPQPPRQQALPPAAPPAPVAPVWPTPSSAGCSCGSSARSRAARASISPATSASSLSVP 145
           P  P PP     P  APP+P +P  P+P+    +  S A    A  S +P + A     P
Sbjct: 60  PPSPAPP-SPGPPSPAPPSPPSPAPPSPAPPSPAPPSPAPPSPAPPSPAPPSPAPPSPAP 118

Query: 144 ARCPS 130
              PS
Sbjct: 119 PSPPS 123

 Score = 28.9 bits (63), Expect(2) = 2e-10
 Identities = 16/51 (31%), Positives = 21/51 (40%)
 Frame = -1

Query: 248 PHPAAPAVAAAAAPGHEPPAPPSHLRRLPPASLSRPGVHHDAAAADTQPQA 96
           P PA P+  + A P    PAPPS     PP+ +         A    +P A
Sbjct: 213 PSPAPPSPPSPAPPSPPSPAPPSPSPPAPPSPVPPSPAPPSPAPPSPKPPA 263

>pir||S22697 extensin - Volvox carteri (fragment) gi|21992|emb|CAA46283.1|
           extensin [Volvox carteri]
          Length = 464

 Score = 57.0 bits (136), Expect = 3e-07
 Identities = 35/99 (35%), Positives = 41/99 (41%)
 Frame = -2

Query: 553 PRRRGPQGLTPMPPLLSSFQPPEQVPPSHAPQAAAPSGSSSTSGMTQS*QSRPPARAPPS 374
           P R  P    P PP      PP   PP  +P    P  S S      S    PP  +PP 
Sbjct: 324 PPRSSPSPPPPSPP------PPSPPPPRPSPSPPPPRSSPSPPPPVVSPPPPPPRASPPP 377

Query: 373 PSPRPLPPCARTVPPPAPASTAATSASAASSCSPSPSRS 257
           P     PP  R  PP  P S    + +AA+  SP+PSRS
Sbjct: 378 PPASSPPPPPRPPPPSPPPSPPPPATAAANPPSPAPSRS 416

 Score = 55.5 bits (132), Expect(2) = 2e-10
 Identities = 44/113 (38%), Positives = 51/113 (44%), Gaps = 7/113 (6%)
 Frame = -2

Query: 571 ASRCNGPRRRGPQG--LTPMPPL-LSSFQPPEQVPPSHAPQAAAPSGSS----STSGMTQ 413
           A+R   PRR       LT  PPL  +S  PP +VPPS  P  A+P        S S    
Sbjct: 245 ATRSPPPRRITSPSPVLTASPPLPKTSPPPPPRVPPSPPPPVASPPPPPPPRVSPSPPPP 304

Query: 412 S*QSRPPARAPPSPSPRPLPPCARTVPPPAPASTAATSASAASSCSPSPSRSS 254
              S PP   PP PSP P PP +   PPP P+    +      S SP P RSS
Sbjct: 305 QPVSSPPPPPPPRPSPSPPPPRSSPSPPP-PSPPPPSPPPPRPSPSPPPPRSS 356

 Score = 50.4 bits (119), Expect = 2e-05
 Identities = 31/96 (32%), Positives = 39/96 (40%)
 Frame = -2

Query: 553 PRRRGPQGLTPMPPLLSSFQPPEQVPPSHAPQAAAPSGSSSTSGMTQS*QSRPPARAPPS 374
           P R  P   +P PP  S   PP  V P   P  A+P    ++S         PP   PPS
Sbjct: 343 PPRPSP---SPPPPRSSPSPPPPVVSPPPPPPRASPPPPPASS------PPPPPRPPPPS 393

Query: 373 PSPRPLPPCARTVPPPAPASTAATSASAASSCSPSP 266
           P P P PP      PP+PA + + +        P P
Sbjct: 394 PPPSPPPPATAAANPPSPAPSRSRAGGPPLGTRPPP 429

 Score = 46.6 bits (109), Expect = 4e-04
 Identities = 33/98 (33%), Positives = 40/98 (40%), Gaps = 7/98 (7%)
 Frame = -2

Query: 526 TPMPPLLSSFQPPEQVPPSHAPQAAAPSGSSSTSGMTQS*QSRPPARAPPSP-----SPR 362
           +P PP   S  PP         +  +PS   + S         PP R PPSP     SP 
Sbjct: 231 SPPPPARVSSSPPPATRSPPPRRITSPSPVLTASPPLPKTSPPPPPRVPPSPPPPVASPP 290

Query: 361 PLPP--CARTVPPPAPASTAATSASAASSCSPSPSRSS 254
           P PP   + + PPP P S+         S SP P RSS
Sbjct: 291 PPPPPRVSPSPPPPQPVSSPPPPPPPRPSPSPPPPRSS 328

 Score = 43.9 bits (102), Expect = 0.002
 Identities = 46/175 (26%), Positives = 58/175 (32%), Gaps = 8/175 (4%)
 Frame = -3

Query: 675 TPSPVARRASAAQGWEAARSPRAAADTTPPWRSPSPPDATARGGAARKG*HPCRHCCLHS 496
           +PSPV   +           PR      PP  SP PP    R   +     P       S
Sbjct: 256 SPSPVLTASPPLPKTSPPPPPRVPPSPPPPVASPPPPPPP-RVSPSPPPPQPV------S 308

Query: 495 NRQNRCPLRTRPKPPRPQA--------PLQPQE*PSRSNPGRLPERRQVPAHGRCRRAPG 340
           +     P R  P PP P++        P  P   P R +P   P R   P+      +P 
Sbjct: 309 SPPPPPPPRPSPSPPPPRSSPSPPPPSPPPPSPPPPRPSPSPPPPRSS-PSPPPPVVSPP 367

Query: 339 QCRRRPQHPQPPRQQALPPAAPPAPVAPVWPTPSSAGCSCGSSARSRAARASISP 175
               R   P PP     PP  PP P  P  P P +   +   S     +RA   P
Sbjct: 368 PPPPRASPPPPPASSPPPPPRPPPPSPPPSPPPPATAAANPPSPAPSRSRAGGPP 422

 Score = 42.4 bits (98), Expect = 0.007
 Identities = 35/93 (37%), Positives = 39/93 (41%), Gaps = 2/93 (2%)
 Frame = -2

Query: 526 TPMPPLLSSFQPPEQVPPSHAPQAAAPSGSSSTSGMTQS*QSRPPARAPPSPSP--RPLP 353
           TP PP      PP +V  S  P A     SSS    T+S    PP R   SPSP     P
Sbjct: 219 TPSPP------PPPRVSTSPPPPARV---SSSPPPATRS----PPPRRITSPSPVLTASP 265

Query: 352 PCARTVPPPAPASTAATSASAASSCSPSPSRSS 254
           P  +T PPP P    +     AS   P P R S
Sbjct: 266 PLPKTSPPPPPRVPPSPPPPVASPPPPPPPRVS 298

 Score = 38.5 bits (88), Expect = 0.097
 Identities = 29/97 (29%), Positives = 38/97 (38%)
 Frame = -2

Query: 616 SPRSSRHNASVAIAVASRCNGPRRRGPQGLTPMPPLLSSFQPPEQVPPSHAPQAAAPSGS 437
           SP   R + S    V S    P R  P      PP  +S  PP   PP  +P  + P  +
Sbjct: 349 SPPPPRSSPSPPPPVVSPPPPPPRASP------PPPPASSPPPPPRPPPPSPPPSPPPPA 402

Query: 436 SSTSGMTQS*QSRPPARAPPSPSPRPLPPCARTVPPP 326
           ++ +       SR  A  PP  +  P PP     PPP
Sbjct: 403 TAAANPPSPAPSRSRAGGPPLGTRPPPPPPEDDAPPP 439

 Score = 38.5 bits (88), Expect = 0.097
 Identities = 36/132 (27%), Positives = 40/132 (30%), Gaps = 3/132 (2%)
 Frame = -3

Query: 615 PRAAADTTPPWRSPSPPDATARGGAARKG*HPCRHCCLHSNRQNRCPLRTRPKPPRPQAP 436
           PR +    PP  SPSPP              P              P      PP P  P
Sbjct: 344 PRPSPSPPPPRSSPSPPPPVVSPPPPPPRASP--------------PPPPASSPPPPPRP 389

Query: 435 LQPQE*PSRSNPGRLPERRQVPAHGRCRRAPGQCRRRPQHPQPPRQQALPP---AAPPAP 265
             P   PS   P         PA  R R        RP  P PP   A PP     PP  
Sbjct: 390 PPPSPPPSPPPPATAAANPPSPAPSRSRAGGPPLGTRPP-PPPPEDDAPPPDYYFPPPQD 448

Query: 264 VAPVWPTPSSAG 229
           ++P  P   + G
Sbjct: 449 MSPPPPKKKATG 460

 Score = 31.6 bits (70), Expect(2) = 2e-10
 Identities = 21/67 (31%), Positives = 23/67 (33%)
 Frame = -1

Query: 275 PQPQSLQCGPHPAAPAVAAAAAPGHEPPAPPSHLRRLPPASLSRPGVHHDAAAADTQPQA 96
           P P      P P  P  +    P   PP PP   R  PP+    P     AAA    P  
Sbjct: 357 PSPPPPVVSPPPPPPRASPPPPPASSPPPPP---RPPPPSPPPSPPPPATAAANPPSPAP 413

Query: 95  CRRRGHG 75
            R R  G
Sbjct: 414 SRSRAGG 420

>ref|XP_046305.3| similar to KIAA1205 protein [Homo sapiens]
          Length = 1576

 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 34/108 (31%), Positives = 46/108 (42%), Gaps = 3/108 (2%)
 Frame = -2

Query: 526  TPMPPLLSSFQPPEQVPPSHAPQAAAPSGSSSTSGMTQS*Q---SRPPARAPPSPSPRPL 356
            TP PPLL   +PP   PP+  PQ   P           S     +  P+  PP P P P 
Sbjct: 1004 TPEPPLLEE-KPPPTPPPAPTPQPQPPPPPPPPQPALPSPPPLVAPTPSSPPPPPLPPPP 1062

Query: 355  PPCARTVPPPAPASTAATSASAASSCSPSPSRSSVAHTQQRRL*LRQQ 212
            PP   + PPP P + A  +A      +PSP    +  T+   L  +Q+
Sbjct: 1063 PPAMPSPPPPPPPAAAPLAAPPEEPAAPSPEDPELPDTRPLHLAKKQE 1110

 Score = 46.6 bits (109), Expect(2) = 9e-09
 Identities = 34/109 (31%), Positives = 50/109 (45%), Gaps = 1/109 (0%)
 Frame = -2

Query: 589  SVAIAVASRCNGPRRRGPQGL-TPMPPLLSSFQPPEQVPPSHAPQAAAPSGSSSTSGMTQ 413
            S++ A+ S  + P   GP+   TP  P L+    P    P   P    PS +S+ +    
Sbjct: 954  SISSAI-SALDDPPLAGPKDTSTPDGPPLA----PAAAVPGPPPLPGLPSANSNGTPEPP 1008

Query: 412  S*QSRPPARAPPSPSPRPLPPCARTVPPPAPASTAATSASAASSCSPSP 266
              + +PP   PP+P+P+P PP     PPP PA  +     A +  SP P
Sbjct: 1009 LLEEKPPPTPPPAPTPQPQPP--PPPPPPQPALPSPPPLVAPTPSSPPP 1055

 Score = 35.8 bits (81), Expect = 0.63
 Identities = 23/62 (37%), Positives = 28/62 (45%), Gaps = 3/62 (4%)
 Frame = -2

Query: 406 QSRPPARAPPSPSPRPLPPCARTVPPPAPASTAATSASAASSCSPSPS---RSSVAHTQQ 236
           QS P   APP P P P        PPPAPAS      ++   CS  P    ++S  H  +
Sbjct: 588 QSGPHQAAPPPPPPPP--------PPPAPASEPKGGLTSPIFCSTKPKKLLKTSSFHLLR 639

Query: 235 RR 230
           RR
Sbjct: 640 RR 641

 Score = 35.0 bits (79), Expect(2) = 9e-09
 Identities = 23/71 (32%), Positives = 28/71 (39%), Gaps = 2/71 (2%)
 Frame = -1

Query: 275  PQPQSLQCGPHPAAPAVAAAAAPGHEPPAPPSHLRRLPPASLSRPGVHHDAAA--ADTQP 102
            P P ++   P P  PA A  AAP  EP AP      LP           + AA   +T  
Sbjct: 1061 PPPPAMPSPPPPPPPAAAPLAAPPEEPAAPSPEDPELPDTRPLHLAKKQETAAVCGETDE 1120

Query: 101  QACRRRGHGCF 69
            +A    G G F
Sbjct: 1121 EAGESGGEGIF 1131

 Score = 33.1 bits (74), Expect = 4.1
 Identities = 33/132 (25%), Positives = 47/132 (35%), Gaps = 9/132 (6%)
 Frame = -2

Query: 622  PQSPRSSRHNASVAIAVASRCNGPRRRGPQGLTPMPPLLSSFQPPEQVPPSHAPQAAAPS 443
            P   R S    +   A  S    P+   P      P   +S +PPEQ P +  P+  AP 
Sbjct: 1228 PVPVRRSGQAKNPVSAGGSSAPPPKAPAPPPKPETPEKTTSEKPPEQTPETAMPEPPAPE 1287

Query: 442  GSSSTSGM----TQS*QSRPP---ARAPPSPS--PRPLPPCARTVPPPAPASTAATSASA 290
              S    +     +  Q+RP    A   P+ S  P+  P   +  PPP         A  
Sbjct: 1288 KPSLLRPVEKEKEKEKQTRPERSLATGQPATSRLPKARPTKVKAEPPPKKRKKWLKEAGG 1347

Query: 289  ASSCSPSPSRSS 254
             ++    P  SS
Sbjct: 1348 NATAGGGPPGSS 1359

 Score = 32.7 bits (73), Expect = 5.3
 Identities = 40/183 (21%), Positives = 58/183 (30%), Gaps = 3/183 (1%)
 Frame = -3

Query: 678  HTPSPVARRASAAQGWEAARSPRAAADTTPPWRSPSPPDATARGGAARKG*HPCRHCCLH 499
            H P    RR+      +A     A   + PP ++P+PP              P       
Sbjct: 1225 HRPPVPVRRSG-----QAKNPVSAGGSSAPPPKAPAPPPKPETPEKTTSEKPP------- 1272

Query: 498  SNRQNRCPLRTRPKPPRPQAP--LQPQE*PSRSNPGRLPERRQVPAHGRCRRAPGQCRRR 325
                 + P    P+PP P+ P  L+P E          PER          R P   + R
Sbjct: 1273 ----EQTPETAMPEPPAPEKPSLLRPVEKEKEKEKQTRPERSLATGQPATSRLP---KAR 1325

Query: 324  PQHPQPPRQQALPPAAPPAPVAPVWPTPSSAGCSCGSSARSRAARASISP-ATSASSLSV 148
            P   +         A PP      W   +    + G      ++ +  SP A S    +V
Sbjct: 1326 PTKVK---------AEPPPKKRKKWLKEAGGNATAGGGPPGSSSDSESSPGAPSEDERAV 1376

Query: 147  PAR 139
            P R
Sbjct: 1377 PGR 1379

>dbj|BAA86519.1| KIAA1205 protein [Homo sapiens]
          Length = 1217

 Score = 54.3 bits (129), Expect = 2e-06
 Identities = 34/108 (31%), Positives = 46/108 (42%), Gaps = 3/108 (2%)
 Frame = -2

Query: 526 TPMPPLLSSFQPPEQVPPSHAPQAAAPSGSSSTSGMTQS*Q---SRPPARAPPSPSPRPL 356
           TP PPLL   +PP   PP+  PQ   P           S     +  P+  PP P P P 
Sbjct: 628 TPEPPLLEE-KPPPTPPPAPTPQPQPPPPPPPPQPALPSPPPLVAPTPSSPPPPPLPPPP 686

Query: 355 PPCARTVPPPAPASTAATSASAASSCSPSPSRSSVAHTQQRRL*LRQQ 212
           PP   + PPP P + A  +A      +PSP    +  T+   L  +Q+
Sbjct: 687 PPAMPSPPPPPPPAAAPLAAPPEEPAAPSPEDPELPDTRPLHLAKKQE 734

 Score = 46.6 bits (109), Expect(2) = 9e-09
 Identities = 34/109 (31%), Positives = 50/109 (45%), Gaps = 1/109 (0%)
 Frame = -2

Query: 589 SVAIAVASRCNGPRRRGPQGL-TPMPPLLSSFQPPEQVPPSHAPQAAAPSGSSSTSGMTQ 413
           S++ A+ S  + P   GP+   TP  P L+    P    P   P    PS +S+ +    
Sbjct: 578 SISSAI-SALDDPPLAGPKDTSTPDGPPLA----PAAAVPGPPPLPGLPSANSNGTPEPP 632

Query: 412 S*QSRPPARAPPSPSPRPLPPCARTVPPPAPASTAATSASAASSCSPSP 266
             + +PP   PP+P+P+P PP     PPP PA  +     A +  SP P
Sbjct: 633 LLEEKPPPTPPPAPTPQPQPP--PPPPPPQPALPSPPPLVAPTPSSPPP 679

 Score = 35.8 bits (81), Expect = 0.63
 Identities = 23/62 (37%), Positives = 28/62 (45%), Gaps = 3/62 (4%)
 Frame = -2

Query: 406 QSRPPARAPPSPSPRPLPPCARTVPPPAPASTAATSASAASSCSPSPS---RSSVAHTQQ 236
           QS P   APP P P P        PPPAPAS      ++   CS  P    ++S  H  +
Sbjct: 212 QSGPHQAAPPPPPPPP--------PPPAPASEPKGGLTSPIFCSTKPKKLLKTSSFHLLR 263

Query: 235 RR 230
           RR
Sbjct: 264 RR 265

 Score = 35.0 bits (79), Expect(2) = 9e-09
 Identities = 23/71 (32%), Positives = 28/71 (39%), Gaps = 2/71 (2%)
 Frame = -1

Query: 275 PQPQSLQCGPHPAAPAVAAAAAPGHEPPAPPSHLRRLPPASLSRPGVHHDAAA--ADTQP 102
           P P ++   P P  PA A  AAP  EP AP      LP           + AA   +T  
Sbjct: 685 PPPPAMPSPPPPPPPAAAPLAAPPEEPAAPSPEDPELPDTRPLHLAKKQETAAVCGETDE 744

Query: 101 QACRRRGHGCF 69
           +A    G G F
Sbjct: 745 EAGESGGEGIF 755



EST assemble image


clone accession position
1 CL59g02_r AV397886 1 480
2 CL17f12_r AV394138 198 686




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research