KCC000298A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000298A_C01 KCC000298A_c01
ggcaaacACTCACTGCCTTGCTTCAGGTTGAAACTGGCGATGACGAAGTAGTTGGTAGAA
GCCCCCTTCTTGACAAAGAGACGCAACCATGGCAGCTCTAGGGACGCAGCTGGTGGATGC
TCCTACTGCGGGACTGGAGCAGGTGCTCTACCGTCTCCAGGAGAAGCGTGTTGCCCTGGA
GAGGGTCGTGCTGCAGTATGGCGAGGCCCCCGCGGGTATTAAGGAGGTGTTTGAGCTGTG
CCGTGGCTTTGAGCGAGCCTACACTAGTTTTATCAACGAGTCTCCGGTGGCCAGCAAGAT
CAAGGAGGCATTCCTGGGTGAGAAGGGCCTGGCGGGCAAGGTCAAGAAGCTGCCCATGGA
CAAGGTGTACGACCTGAAGAACGTCAAGGCGGCATGCCGGCAGGCGGACGGCTACCAGAT
GAGCCTCGTGGCGCCGGAGAAGGGTCTGCGCCTGGTGACCACGGAGGCTCTGGACTTCGT
GACGGACCCCGTCAACACGTGCGTGCAGGAGGTGTACA


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000298A_C01 KCC000298A_c01
         (518 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

dbj|BAA88113.1| dynamin-like protein [Arabidopsis thaliana]            75  5e-13
ref|NP_176170.1| dynamin-related protein [Arabidopsis thaliana] ...    75  5e-13
dbj|BAA77516.1| a dynamin-like protein ADL3 [Arabidopsis thaliana]     75  5e-13
gb|AAF79753.1|AC009317_12 T30E16.17 [Arabidopsis thaliana]             75  5e-13
pir||H96619 protein T30E16.17 [imported] - Arabidopsis thaliana        75  5e-13

>dbj|BAA88113.1| dynamin-like protein [Arabidopsis thaliana]
          Length = 921

 Score = 75.1 bits (183), Expect = 5e-13
 Identities = 50/153 (32%), Positives = 74/153 (47%), Gaps = 6/153 (3%)
 Frame = +2

Query: 77  RDATMAALGTQLVDAPTAGLEQVLYRLQEKRVALERVVLQYGEAPAGIKE-----VFELC 241
           R A +  L +Q+       L  +L  LQ K   ++  + + GE      E       ELC
Sbjct: 284 RIALVDTLASQIRSRMKLRLPNILTGLQGKSQIVQDELARLGEQLVSSAEGTRAIALELC 343

Query: 242 RGFERAYTSFINESPVAS-KIKEAFLGEKGLAGKVKKLPMDKVYDLKNVKAACRQADGYQ 418
           R FE  +   +     +  K+  +F G      ++KKLP+D+ +DL NVK    +ADGYQ
Sbjct: 344 REFEDKFLLHLAGGEGSGWKVVASFEGN--FPNRIKKLPLDRHFDLNNVKRIVLEADGYQ 401

Query: 419 MSLVAPEKGLRLVTTEALDFVTDPVNTCVQEVY 517
             L++PEKGLR +    L+   DP   CV EV+
Sbjct: 402 PYLISPEKGLRSLIKTVLELAKDPARLCVDEVH 434

>ref|NP_176170.1| dynamin-related protein [Arabidopsis thaliana]
           gi|25453548|pir||T52426 dynamin-like protein [imported]
           - Arabidopsis thaliana gi|6526969|dbj|BAA88111.1|
           dynamin-like protein [Arabidopsis thaliana]
           gi|15146179|gb|AAK83573.1| At1g59610/T30E16_17
           [Arabidopsis thaliana] gi|23397259|gb|AAN31911.1|
           putative dynamin protein [Arabidopsis thaliana]
           gi|32815841|gb|AAP88329.1| At1g59610/T30E16_17
           [Arabidopsis thaliana]
          Length = 920

 Score = 75.1 bits (183), Expect = 5e-13
 Identities = 50/153 (32%), Positives = 74/153 (47%), Gaps = 6/153 (3%)
 Frame = +2

Query: 77  RDATMAALGTQLVDAPTAGLEQVLYRLQEKRVALERVVLQYGEAPAGIKE-----VFELC 241
           R A +  L +Q+       L  +L  LQ K   ++  + + GE      E       ELC
Sbjct: 283 RIALVDTLASQIRSRMKLRLPNILTGLQGKSQIVQDELARLGEQLVSSAEGTRAIALELC 342

Query: 242 RGFERAYTSFINESPVAS-KIKEAFLGEKGLAGKVKKLPMDKVYDLKNVKAACRQADGYQ 418
           R FE  +   +     +  K+  +F G      ++KKLP+D+ +DL NVK    +ADGYQ
Sbjct: 343 REFEDKFLLHLAGGEGSGWKVVASFEGN--FPNRIKKLPLDRHFDLNNVKRIVLEADGYQ 400

Query: 419 MSLVAPEKGLRLVTTEALDFVTDPVNTCVQEVY 517
             L++PEKGLR +    L+   DP   CV EV+
Sbjct: 401 PYLISPEKGLRSLIKTVLELAKDPARLCVDEVH 433

>dbj|BAA77516.1| a dynamin-like protein ADL3 [Arabidopsis thaliana]
          Length = 836

 Score = 75.1 bits (183), Expect = 5e-13
 Identities = 50/153 (32%), Positives = 74/153 (47%), Gaps = 6/153 (3%)
 Frame = +2

Query: 77  RDATMAALGTQLVDAPTAGLEQVLYRLQEKRVALERVVLQYGEAPAGIKE-----VFELC 241
           R A +  L +Q+       L  +L  LQ K   ++  + + GE      E       ELC
Sbjct: 283 RIALVDTLASQIRSRMKLRLPNILTGLQGKSQIVQDELARLGEQLVSSAEGTRAIALELC 342

Query: 242 RGFERAYTSFINESPVAS-KIKEAFLGEKGLAGKVKKLPMDKVYDLKNVKAACRQADGYQ 418
           R FE  +   +     +  K+  +F G      ++KKLP+D+ +DL NVK    +ADGYQ
Sbjct: 343 REFEDKFLLHLAGGEGSGWKVVASFEGN--FPNRIKKLPLDRHFDLNNVKRIVLEADGYQ 400

Query: 419 MSLVAPEKGLRLVTTEALDFVTDPVNTCVQEVY 517
             L++PEKGLR +    L+   DP   CV EV+
Sbjct: 401 PYLISPEKGLRSLIKTVLELAKDPARLCVDEVH 433

>gb|AAF79753.1|AC009317_12 T30E16.17 [Arabidopsis thaliana]
          Length = 1092

 Score = 75.1 bits (183), Expect = 5e-13
 Identities = 50/153 (32%), Positives = 74/153 (47%), Gaps = 6/153 (3%)
 Frame = +2

Query: 77  RDATMAALGTQLVDAPTAGLEQVLYRLQEKRVALERVVLQYGEAPAGIKE-----VFELC 241
           R A +  L +Q+       L  +L  LQ K   ++  + + GE      E       ELC
Sbjct: 389 RIALVDTLASQIRSRMKLRLPNILTGLQGKSQIVQDELARLGEQLVSSAEGTRAIALELC 448

Query: 242 RGFERAYTSFINESPVAS-KIKEAFLGEKGLAGKVKKLPMDKVYDLKNVKAACRQADGYQ 418
           R FE  +   +     +  K+  +F G      ++KKLP+D+ +DL NVK    +ADGYQ
Sbjct: 449 REFEDKFLLHLAGGEGSGWKVVASFEGN--FPNRIKKLPLDRHFDLNNVKRIVLEADGYQ 506

Query: 419 MSLVAPEKGLRLVTTEALDFVTDPVNTCVQEVY 517
             L++PEKGLR +    L+   DP   CV EV+
Sbjct: 507 PYLISPEKGLRSLIKTVLELAKDPARLCVDEVH 539

>pir||H96619 protein T30E16.17 [imported] - Arabidopsis thaliana
          Length = 1092

 Score = 75.1 bits (183), Expect = 5e-13
 Identities = 50/153 (32%), Positives = 74/153 (47%), Gaps = 6/153 (3%)
 Frame = +2

Query: 77  RDATMAALGTQLVDAPTAGLEQVLYRLQEKRVALERVVLQYGEAPAGIKE-----VFELC 241
           R A +  L +Q+       L  +L  LQ K   ++  + + GE      E       ELC
Sbjct: 389 RIALVDTLASQIRSRMKLRLPNILTGLQGKSQIVQDELARLGEQLVSSAEGTRAIALELC 448

Query: 242 RGFERAYTSFINESPVAS-KIKEAFLGEKGLAGKVKKLPMDKVYDLKNVKAACRQADGYQ 418
           R FE  +   +     +  K+  +F G      ++KKLP+D+ +DL NVK    +ADGYQ
Sbjct: 449 REFEDKFLLHLAGGEGSGWKVVASFEGN--FPNRIKKLPLDRHFDLNNVKRIVLEADGYQ 506

Query: 419 MSLVAPEKGLRLVTTEALDFVTDPVNTCVQEVY 517
             L++PEKGLR +    L+   DP   CV EV+
Sbjct: 507 PYLISPEKGLRSLIKTVLELAKDPARLCVDEVH 539



EST assemble image


clone accession position
1 HCL090g09_r AV644576 1 302
2 LCL070g02_r AV629998 8 210
3 CL17f05_r AV394109 13 518




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research