KCC000297A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000297A_C01 KCC000297A_c01
cttgaTTCGGACATATATTCATGTACTTAAGGTCCACCTAGGAGCACGAACTCGGCTGAA
GGCCCTAGTCCATTTCGCGTCGGCACGAAAATGGTCGGGGGCGGCATTTTGAGTAGACGA
CCTGCATGTCTTAGTGGTGATGGCAAACTCATACTATGTCCCTGCGGGCGGCTGGTTCAC
ATCTACAGCGCCGTCACCGGAGAGCGCGTTGGCTCGCTGGTTGGCCATGCCGACGAGGTC
ACGGGCGTTATATTGGACCCCGAGAATGCAGACCAGGTGTACACCTGCTCCATGGACGCG
ACGGTGCGGCTGTGGGACTACCGCTCGGGCGAGGAACTCAGTCGCGTGACGGCGCGGGAG
CCTGTTAAGCACATGGTGATCCACAAGGGCCTTGGGGTGGCCTATCTGTCCATGCAGCTG
CGCGAGGGCGGCGGGCGCGTGGTGCTGTACAACATCCGTACAGGCA


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000297A_C01 KCC000297A_c01
         (466 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

dbj|BAB14111.1| unnamed protein product [Homo sapiens]                 76  2e-13
ref|NP_115544.1| hypothetical protein FLJ12519 [Homo sapiens] gi...    76  2e-13
dbj|BAB14126.1| unnamed protein product [Homo sapiens]                 76  2e-13
gb|AAH45446.1| Unknown (protein for MGC:55748) [Danio rerio]           75  4e-13
emb|CAD61075.1| SI:dZ46I22.2 (novel protein) [Danio rerio]             75  4e-13

>dbj|BAB14111.1| unnamed protein product [Homo sapiens]
          Length = 782

 Score = 76.3 bits (186), Expect = 2e-13
 Identities = 38/78 (48%), Positives = 48/78 (60%)
 Frame = +1

Query: 97  GGGILSRRPACLSGDGKLILCPCGRLVHIYSAVTGERVGSLVGHADEVTGVILDPENADQ 276
           GG  L+ R A  S D K I C  G  V +YS VT E V  L GH + VTG+ L+P N  Q
Sbjct: 13  GGSELNFRRAVFSADSKYIFCVSGDFVKVYSTVTEECVHILHGHRNLVTGIQLNPNNHLQ 72

Query: 277 VYTCSMDATVRLWDYRSG 330
           +Y+CS+D T++LWDY  G
Sbjct: 73  LYSCSLDGTIKLWDYIDG 90

>ref|NP_115544.1| hypothetical protein FLJ12519 [Homo sapiens]
           gi|26251828|gb|AAH40567.1| Hypothetical protein FLJ12519
           [Homo sapiens]
          Length = 830

 Score = 76.3 bits (186), Expect = 2e-13
 Identities = 38/78 (48%), Positives = 48/78 (60%)
 Frame = +1

Query: 97  GGGILSRRPACLSGDGKLILCPCGRLVHIYSAVTGERVGSLVGHADEVTGVILDPENADQ 276
           GG  L+ R A  S D K I C  G  V +YS VT E V  L GH + VTG+ L+P N  Q
Sbjct: 13  GGSELNFRRAVFSADSKYIFCVSGDFVKVYSTVTEECVHILHGHRNLVTGIQLNPNNHLQ 72

Query: 277 VYTCSMDATVRLWDYRSG 330
           +Y+CS+D T++LWDY  G
Sbjct: 73  LYSCSLDGTIKLWDYIDG 90

>dbj|BAB14126.1| unnamed protein product [Homo sapiens]
          Length = 773

 Score = 76.3 bits (186), Expect = 2e-13
 Identities = 38/78 (48%), Positives = 48/78 (60%)
 Frame = +1

Query: 97  GGGILSRRPACLSGDGKLILCPCGRLVHIYSAVTGERVGSLVGHADEVTGVILDPENADQ 276
           GG  L+ R A  S D K I C  G  V +YS VT E V  L GH + VTG+ L+P N  Q
Sbjct: 13  GGSELNFRRAVFSADSKYIFCVSGDFVKVYSTVTEECVHILHGHRNLVTGIQLNPNNHLQ 72

Query: 277 VYTCSMDATVRLWDYRSG 330
           +Y+CS+D T++LWDY  G
Sbjct: 73  LYSCSLDGTIKLWDYIDG 90

>gb|AAH45446.1| Unknown (protein for MGC:55748) [Danio rerio]
          Length = 832

 Score = 75.1 bits (183), Expect = 4e-13
 Identities = 39/109 (35%), Positives = 61/109 (55%), Gaps = 3/109 (2%)
 Frame = +1

Query: 97  GGGILSRRPACLSGDGKLILCPCGRLVHIYSAVTGERVGSLVGHADEVTGVILDPENADQ 276
           GG  ++ RP  +S D + +LC  G  V +YS  T E + +L GH ++VTG+  +P N  Q
Sbjct: 13  GGSKINFRPPIISHDSRFVLCVSGDSVKVYSTRTEEWLHNLQGHNNQVTGIAFNPANQLQ 72

Query: 277 VYTCSMDATVRLWDYRSGEELSRVTAREPVKHMVI---HKGLGVAYLSM 414
           VY+CS D TV+LWD+  G  +       P+  + +   H+G+    +SM
Sbjct: 73  VYSCSADGTVKLWDFIDGILIKTFVIGYPLYSLYVSEKHEGVIFLIVSM 121

>emb|CAD61075.1| SI:dZ46I22.2 (novel protein) [Danio rerio]
          Length = 760

 Score = 75.1 bits (183), Expect = 4e-13
 Identities = 39/109 (35%), Positives = 61/109 (55%), Gaps = 3/109 (2%)
 Frame = +1

Query: 97  GGGILSRRPACLSGDGKLILCPCGRLVHIYSAVTGERVGSLVGHADEVTGVILDPENADQ 276
           GG  ++ RP  +S D + +LC  G  V +YS  T E + +L GH ++VTG+  +P N  Q
Sbjct: 13  GGSKINFRPPIISHDSRFVLCVSGDSVKVYSTRTEEWLHNLQGHNNQVTGIAFNPANQLQ 72

Query: 277 VYTCSMDATVRLWDYRSGEELSRVTAREPVKHMVI---HKGLGVAYLSM 414
           VY+CS D TV+LWD+  G  +       P+  + +   H+G+    +SM
Sbjct: 73  VYSCSADGTVKLWDFIDGILIKTFVIGYPLYSLYVSEKHEGVIFLIVSM 121



EST assemble image


clone accession position
1 MXL043b07_r BP095523 1 450
2 CL34h05_r AV394910 6 334
3 HCL084f09_r AV644246 7 470
4 HCL092e11_r AV644702 35 412
5 CL17e03_r AV394131 225 350




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research