KCC000296A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000296A_C01 KCC000296A_c01
GCTTAAGCGGCCTCTTCAGCTTTCAAAACAGCTCCTTAACCGTTTTCTTTTTCGCGGGCC
TGAGGCCCTGTTCGAAGCACAACCAGCAAAGCATGGCTGCCGCGCCGGTTGAGCGCACCG
GTTTCGATGACCGCGCCTTCGACACGAAGATGCAGCAGTTCCTGGGCAACAACGAGGACA
AGTTCTACACCGACTGGGCAGGAGAGCTTTGAGCAGCTTCGACCAGATGAACCTGCACGA
GAACCTGCTGGCGCCGGCATTTACCGCGTACGGTTTCGAGAAGCCCTCGGCCATTCAGTC
GAAGGGTATCGTGCCGTTCACCAAGGGCCTGGACGTGATTCAGCAGGCCCAGTCGGGCAC
GGGCAAGACCGCCACCTTCTGCGCCGGCATCGCTGAACAACATCGATTACAACTCGAACG
AGTGCCAGGCGCTGGTGCTGGCTCCCACCCGTGAGCTGGCGCAGCAGATTGAGAAGGTCA
TGCGCGCCCTGGGCGACTTCCTGCAGGTTAAGTGCCACGCCTGCGTGGGTGGCACCAGCG
TGCGTGAGGACGCCCGCATCCTGGGCGCCGGCGTGCAGGTCGTGGTCGGTACCCCCGGCC
GTGTCTTCGACATGCTGCGCCGCCGCTACCTGCGCGCGGACTCCATCAAGATGTTCACCC
TGGACGAGGCCGATGAGATGCTGTCTCGCGGTTTCAAGGACCAGATCTACGACATCTTCC
AGCTGCTGCCCCCCAAGCTGCAGGTCGGTGTGTTCTCCGCCACCCTGCCCCCTGAGGCGC
TGGAGATTACCCGCAAGTTCATGAACAAGCCCGTGCGCATTCTGGTGAAGCGCGATGAGC
TGACCCTGGAGGGTATCAAGCAGTTCTACGTGAACTGTGGACAAGGAGGAGTGGAAGCTG
GACACGCTGTGCGACCTGTACGAGACGCTGGCCATCACCCAGTCCGTCATCTTCGCCAAC
ACCCGCCGCAAGGTGGACTGGCTGACGGACAAGATGCGCGAGCGCGACCACACCGTGTCC
GCCACCCACGGCGACATGGACCAGAACACGCGCGATGTGATCATGCGCGAGTTCCGCTCC
GGCTCGTCGCGTGTGCTGATCACCACCGACCTGCTGGCCCGCGGCATTGACGTGCAGCAG
GTGTCGCTGGTCATCAACTACGACCTGCCCACCCAGCCCGAGAACTACCTGCACCGCATT
GGTCGCTCGGGCCGCTTCGGACGCAAGGGTGTTGCCATCAACTTCGTGACCAAGGACGAC
GAGCGCATGCTCCAGGACATCCAGCGGTTCTACAACACCGTGATTGAGGAGCTGCCCTCG
AACGTCGCTGACCTCATCTAAGCGCTCTACTACCACCAAATGTGCGCTAGCCCCTGGGTC
CAGCCGATCCCAAGCACGGGGCGAAGCCTGCAGGATGTGAAGGGCACGGGGCAGGGCGCG
CCGCCACGCAGCCGCCCCGTGACCCGACAACGTGCTGTACGTGCTGCGCTGCGAGTCCTT
TTGAACACGGGCCGTCGTTGCGGGTGGTAAACGTGAACCTGTGTTGAGGCGGGTCGGCGC
AGCTTCGGTTGCAGCCATTTGAGAGAGAAGGAAGTTTGCCGGTTTGCAAACGGCAGGAGT
TTTGTCGCGACCGCCATATGTTTGACGCCTTTTGAGAGTGCCACACCGCTGCCCAACCTA
TTCGTATGACTGTAAGGACGCAAGTCTGCGAAAAAAAAAAAAAAACAnnaaaaaaaacaa
a


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000296A_C01 KCC000296A_c01
         (1741 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

sp|P41382|IF4U_TOBAC Eukaryotic initiation factor 4A-10 (eIF4A-1...   297  e-157
sp|P41379|IF42_NICPL Eukaryotic initiation factor 4A-2 (eIF4A-2)...   293  e-157
pir||S52019 translation initiation factor eIF-4A.7 - common tobacco   295  e-157
sp|Q40470|IF47_TOBAC Eukaryotic initiation factor 4A-7 (eIF4A-7)...   295  e-156
pir||S52023 translation initiation factor eIF-4A.14 - common tob...   296  e-156

>sp|P41382|IF4U_TOBAC Eukaryotic initiation factor 4A-10 (eIF4A-10) (eIF-4A-10)
            gi|1362118|pir||S55898 translation initiation factor
            eIF-4A.10 - common tobacco gi|475213|emb|CAA55642.1|
            translation initiation factor (eIF-4A) [Nicotiana
            tabacum] gi|475216|emb|CAA55641.1| translation initiation
            factor (eIF-4A) [Nicotiana tabacum]
          Length = 413

 Score =  297 bits (760), Expect(2) = e-157
 Identities = 145/154 (94%), Positives = 150/154 (97%)
 Frame = +1

Query: 877  VDKEEWKLDTLCDLYETLAITQSVIFANTRRKVDWLTDKMRERDHTVSATHGDMDQNTRD 1056
            VDKEEWKL+TLCDLYETLAITQSVIF NTRRKVDWLTDKMR RDHTVSATHGDMDQNTRD
Sbjct: 260  VDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRD 319

Query: 1057 VIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVA 1236
            +IMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVA
Sbjct: 320  IIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVA 379

Query: 1237 INFVTKDDERMLQDIQRFYNTVIEELPSNVADLI 1338
            INFVTKDDERML DIQ+FYN VIEELP+NVADL+
Sbjct: 380  INFVTKDDERMLSDIQKFYNVVIEELPANVADLL 413

 Score =  282 bits (722), Expect(2) = e-157
 Identities = 157/267 (58%), Positives = 182/267 (67%), Gaps = 6/267 (2%)
 Frame = +3

Query: 93  MAAAPVERTGFDDRAFDTKMQQFLGNNEDKFYTDWA---GEL*AASTR*TCTRTCWRRHL 263
           MA    E + FD R +D KM + LG  +++F+T +        A   +    R  +    
Sbjct: 1   MAGLAPEGSQFDARQYDAKMTELLGTEQEEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF 60

Query: 264 PRTVSRSPR---PFSRRVSCRSPRAWT*FSRPSRARARPPPSAPASLNNIDYNSNECQAL 434
            +  +   R   PF + +            +      +        L  +DY+  ECQAL
Sbjct: 61  EKPSAIQQRGIVPFCKGLDV--------IQQAQSGTGKTATFCSGVLQQLDYSLVECQAL 112

Query: 435 VLAPTRELAQQIEKVMRALGDFLQVKCHACVGGTSVREDARILGAGVQVVVGTPGRVFDM 614
           VLAPTRELAQQIEKVMRALGD+L VK HACVGGTSVRED RIL +GV VVVGTPGRVFDM
Sbjct: 113 VLAPTRELAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQSGVHVVVGTPGRVFDM 172

Query: 615 LRRRYLRADSIKMFTLDEADEMLSRGFKDQIYDIFQLLPPKLQVGVFSATLPPEALEITR 794
           LRR+ LR D IKMF LDEADEMLSRGFKDQIYDIFQLLPPK+QVGVFSAT+PPEALEITR
Sbjct: 173 LRRQSLRPDHIKMFVLDEADEMLSRGFKDQIYDIFQLLPPKIQVGVFSATMPPEALEITR 232

Query: 795 KFMNKPVRILVKRDELTLEGIKQFYVN 875
           KFMNKPVRILVKRD++TLEGIKQFYVN
Sbjct: 233 KFMNKPVRILVKRDDVTLEGIKQFYVN 259

 Score = 94.7 bits (234), Expect = 4e-18
 Identities = 47/62 (75%), Positives = 52/62 (83%)
 Frame = +2

Query: 215 SFDQMNLHENLLAPAFTAYGFEKPSAIQSKGIVPFTKGLDVIQQAQSGTGKTATFCAGIA 394
           SFD M L ENLL   + AYGFEKPSAIQ +GIVPF KGLDVIQQAQSGTGKTATFC+G+ 
Sbjct: 41  SFDAMGLQENLLRGIY-AYGFEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVL 99

Query: 395 EQ 400
           +Q
Sbjct: 100 QQ 101

>sp|P41379|IF42_NICPL Eukaryotic initiation factor 4A-2 (eIF4A-2) (eIF-4A-2)
            gi|100275|pir||S22578 translation initiation factor
            eIF-4A - curled-leaved tobacco gi|19697|emb|CAA43513.1|
            nicotiana eukaryotic translation initiation factor 4A
            [Nicotiana plumbaginifolia]
          Length = 413

 Score =  293 bits (749), Expect(2) = e-157
 Identities = 144/154 (93%), Positives = 149/154 (96%)
 Frame = +1

Query: 877  VDKEEWKLDTLCDLYETLAITQSVIFANTRRKVDWLTDKMRERDHTVSATHGDMDQNTRD 1056
            VDKEEWKL+TLCDLYETLAITQSVIF NTRRKVDWLTDKMR RDHTVSATHGDMDQNTRD
Sbjct: 260  VDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRD 319

Query: 1057 VIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVA 1236
            +IMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVA
Sbjct: 320  IIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVA 379

Query: 1237 INFVTKDDERMLQDIQRFYNTVIEELPSNVADLI 1338
            IN VTKDDERML DIQ+FYN VIEELP+NVADL+
Sbjct: 380  INSVTKDDERMLFDIQKFYNVVIEELPANVADLL 413

 Score =  286 bits (733), Expect(2) = e-157
 Identities = 160/267 (59%), Positives = 183/267 (67%), Gaps = 6/267 (2%)
 Frame = +3

Query: 93  MAAAPVERTGFDDRAFDTKMQQFLGNNEDKFYTDWA---GEL*AASTR*TCTRTCWRRHL 263
           MA +  E + FD R FD KM + LG  +++F+T +        A   +    R  +    
Sbjct: 1   MAGSAPEGSQFDARQFDAKMTELLGTEQEEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF 60

Query: 264 PRTVSRSPR---PFSRRVSCRSPRAWT*FSRPSRARARPPPSAPASLNNIDYNSNECQAL 434
            +  +   R   PF + +            +      +        L  +DY+  ECQAL
Sbjct: 61  EKPSAIQQRGIVPFCKGLDV--------IQQAQSGTGKTATFCSGVLQQLDYSLVECQAL 112

Query: 435 VLAPTRELAQQIEKVMRALGDFLQVKCHACVGGTSVREDARILGAGVQVVVGTPGRVFDM 614
           VLAPTRELAQQIEKVMRALGD+L VK HACVGGTSVRED RIL +GV VVVGTPGRVFDM
Sbjct: 113 VLAPTRELAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQSGVHVVVGTPGRVFDM 172

Query: 615 LRRRYLRADSIKMFTLDEADEMLSRGFKDQIYDIFQLLPPKLQVGVFSATLPPEALEITR 794
           LRR+ LR D IKMF LDEADEMLSRGFKDQIYDIFQLLPPK+QVGVFSAT+PPEALEITR
Sbjct: 173 LRRQSLRPDHIKMFVLDEADEMLSRGFKDQIYDIFQLLPPKIQVGVFSATMPPEALEITR 232

Query: 795 KFMNKPVRILVKRDELTLEGIKQFYVN 875
           KFMNKPVRILVKRDELTLEGIKQFYVN
Sbjct: 233 KFMNKPVRILVKRDELTLEGIKQFYVN 259

 Score = 94.7 bits (234), Expect = 4e-18
 Identities = 47/62 (75%), Positives = 52/62 (83%)
 Frame = +2

Query: 215 SFDQMNLHENLLAPAFTAYGFEKPSAIQSKGIVPFTKGLDVIQQAQSGTGKTATFCAGIA 394
           SFD M L ENLL   + AYGFEKPSAIQ +GIVPF KGLDVIQQAQSGTGKTATFC+G+ 
Sbjct: 41  SFDAMGLQENLLRGIY-AYGFEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVL 99

Query: 395 EQ 400
           +Q
Sbjct: 100 QQ 101

>pir||S52019 translation initiation factor eIF-4A.7 - common tobacco
          Length = 413

 Score =  295 bits (756), Expect(2) = e-157
 Identities = 145/154 (94%), Positives = 149/154 (96%)
 Frame = +1

Query: 877  VDKEEWKLDTLCDLYETLAITQSVIFANTRRKVDWLTDKMRERDHTVSATHGDMDQNTRD 1056
            VDKEEWKL+TLCDLYETLAITQSVIF NTRRKVDWLTDKMR RDHTVSATHGDMDQNTRD
Sbjct: 260  VDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRTRDHTVSATHGDMDQNTRD 319

Query: 1057 VIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVA 1236
            +IMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVA
Sbjct: 320  IIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVA 379

Query: 1237 INFVTKDDERMLQDIQRFYNTVIEELPSNVADLI 1338
            INFV KDDERML DIQRFYN VIEELP+NVADL+
Sbjct: 380  INFVIKDDERMLSDIQRFYNVVIEELPANVADLL 413

 Score =  283 bits (725), Expect(2) = e-157
 Identities = 158/267 (59%), Positives = 182/267 (67%), Gaps = 6/267 (2%)
 Frame = +3

Query: 93  MAAAPVERTGFDDRAFDTKMQQFLGNNEDKFYTDWA---GEL*AASTR*TCTRTCWRRHL 263
           MA    E + FD R +D KM + LG  +++F+T +        A   +    R  +    
Sbjct: 1   MAGLAPEGSQFDARQYDAKMTELLGTEQEEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF 60

Query: 264 PRTVSRSPR---PFSRRVSCRSPRAWT*FSRPSRARARPPPSAPASLNNIDYNSNECQAL 434
            +  +   R   PF + +            +      +        L  +DY+  ECQAL
Sbjct: 61  EKPSAIQQRGIVPFCKGLDV--------IQQAQSGTGKTATFCSGVLQQLDYSLVECQAL 112

Query: 435 VLAPTRELAQQIEKVMRALGDFLQVKCHACVGGTSVREDARILGAGVQVVVGTPGRVFDM 614
           VLAPTRELAQQIEKVMRALGD+L VK HACVGGTSVRED RIL +GV VVVGTPGRVFDM
Sbjct: 113 VLAPTRELAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQSGVHVVVGTPGRVFDM 172

Query: 615 LRRRYLRADSIKMFTLDEADEMLSRGFKDQIYDIFQLLPPKLQVGVFSATLPPEALEITR 794
           LRR+ LR D IKMF LDEADEMLSRGFKDQIYDIFQLLPPK+QVGVFSAT+PPEALEITR
Sbjct: 173 LRRQSLRPDHIKMFVLDEADEMLSRGFKDQIYDIFQLLPPKIQVGVFSATMPPEALEITR 232

Query: 795 KFMNKPVRILVKRDELTLEGIKQFYVN 875
           KFMNKPVRILVKRDE+TLEGIKQFYVN
Sbjct: 233 KFMNKPVRILVKRDEVTLEGIKQFYVN 259

 Score = 94.7 bits (234), Expect = 4e-18
 Identities = 47/62 (75%), Positives = 52/62 (83%)
 Frame = +2

Query: 215 SFDQMNLHENLLAPAFTAYGFEKPSAIQSKGIVPFTKGLDVIQQAQSGTGKTATFCAGIA 394
           SFD M L ENLL   + AYGFEKPSAIQ +GIVPF KGLDVIQQAQSGTGKTATFC+G+ 
Sbjct: 41  SFDAMGLQENLLRGIY-AYGFEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVL 99

Query: 395 EQ 400
           +Q
Sbjct: 100 QQ 101

>sp|Q40470|IF47_TOBAC Eukaryotic initiation factor 4A-7 (eIF4A-7) (eIF-4A-7)
            gi|485949|emb|CAA55738.1| unnamed protein product
            [Nicotiana tabacum]
          Length = 413

 Score =  295 bits (756), Expect(2) = e-156
 Identities = 145/154 (94%), Positives = 149/154 (96%)
 Frame = +1

Query: 877  VDKEEWKLDTLCDLYETLAITQSVIFANTRRKVDWLTDKMRERDHTVSATHGDMDQNTRD 1056
            VDKEEWKL+TLCDLYETLAITQSVIF NTRRKVDWLTDKMR RDHTVSATHGDMDQNTRD
Sbjct: 260  VDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRTRDHTVSATHGDMDQNTRD 319

Query: 1057 VIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVA 1236
            +IMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVA
Sbjct: 320  IIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVA 379

Query: 1237 INFVTKDDERMLQDIQRFYNTVIEELPSNVADLI 1338
            INFV KDDERML DIQRFYN VIEELP+NVADL+
Sbjct: 380  INFVIKDDERMLSDIQRFYNVVIEELPANVADLL 413

 Score =  282 bits (722), Expect(2) = e-156
 Identities = 157/267 (58%), Positives = 182/267 (67%), Gaps = 6/267 (2%)
 Frame = +3

Query: 93  MAAAPVERTGFDDRAFDTKMQQFLGNNEDKFYTDWA---GEL*AASTR*TCTRTCWRRHL 263
           MA    E + FD R +D KM + LG  +++F+T +        A   +    R  +    
Sbjct: 1   MAGLAPEGSQFDARQYDAKMTELLGTEQEEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF 60

Query: 264 PRTVSRSPR---PFSRRVSCRSPRAWT*FSRPSRARARPPPSAPASLNNIDYNSNECQAL 434
            +  +   R   PF + +            +      +        L  +DY+  ECQAL
Sbjct: 61  EKPSAIQQRGIVPFCKGLDV--------IQQAQSGTGKTATFCSGVLQQLDYSLVECQAL 112

Query: 435 VLAPTRELAQQIEKVMRALGDFLQVKCHACVGGTSVREDARILGAGVQVVVGTPGRVFDM 614
           VLAPTRELAQQIEKVMRALGD+L VK HACVGGTSVRED RIL +GV VVVGTPGRVFDM
Sbjct: 113 VLAPTRELAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQSGVHVVVGTPGRVFDM 172

Query: 615 LRRRYLRADSIKMFTLDEADEMLSRGFKDQIYDIFQLLPPKLQVGVFSATLPPEALEITR 794
           LRR+ LR D IKMF LDEADEMLSRGFKDQIYDIFQLLPPK+QVGVFSAT+PPEALEITR
Sbjct: 173 LRRQSLRPDHIKMFVLDEADEMLSRGFKDQIYDIFQLLPPKIQVGVFSATMPPEALEITR 232

Query: 795 KFMNKPVRILVKRDELTLEGIKQFYVN 875
           KFMNKPVRILVKRD++TLEGIKQFYVN
Sbjct: 233 KFMNKPVRILVKRDDVTLEGIKQFYVN 259

 Score = 94.7 bits (234), Expect = 4e-18
 Identities = 47/62 (75%), Positives = 52/62 (83%)
 Frame = +2

Query: 215 SFDQMNLHENLLAPAFTAYGFEKPSAIQSKGIVPFTKGLDVIQQAQSGTGKTATFCAGIA 394
           SFD M L ENLL   + AYGFEKPSAIQ +GIVPF KGLDVIQQAQSGTGKTATFC+G+ 
Sbjct: 41  SFDAMGLQENLLRGIY-AYGFEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVL 99

Query: 395 EQ 400
           +Q
Sbjct: 100 QQ 101

>pir||S52023 translation initiation factor eIF-4A.14 - common tobacco
          Length = 413

 Score =  296 bits (757), Expect(2) = e-156
 Identities = 145/154 (94%), Positives = 150/154 (97%)
 Frame = +1

Query: 877  VDKEEWKLDTLCDLYETLAITQSVIFANTRRKVDWLTDKMRERDHTVSATHGDMDQNTRD 1056
            VDKEEWKL+TLCDLYETLAITQSVIF NTRRKVDWLTDKMR RDHTVSATHGDMDQNTRD
Sbjct: 260  VDKEEWKLETLCDLYETLAITQSVIFVNTRRKVDWLTDKMRSRDHTVSATHGDMDQNTRD 319

Query: 1057 VIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVA 1236
            +IMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVA
Sbjct: 320  IIMREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTQPENYLHRIGRSGRFGRKGVA 379

Query: 1237 INFVTKDDERMLQDIQRFYNTVIEELPSNVADLI 1338
            INFVTKDDERML DIQ+FYN VIEELP+NVADL+
Sbjct: 380  INFVTKDDERMLFDIQKFYNVVIEELPANVADLL 413

 Score =  281 bits (720), Expect(2) = e-156
 Identities = 157/267 (58%), Positives = 182/267 (67%), Gaps = 6/267 (2%)
 Frame = +3

Query: 93  MAAAPVERTGFDDRAFDTKMQQFLGNNEDKFYTDWA---GEL*AASTR*TCTRTCWRRHL 263
           MA    E + FD R +D KM + LG  +++F+T +        A   +    R  +    
Sbjct: 1   MAGLAPEGSQFDARQYDAKMTELLGTEQEEFFTSYDEVYDSFDAMGLQENLLRGIYAYGF 60

Query: 264 PRTVSRSPR---PFSRRVSCRSPRAWT*FSRPSRARARPPPSAPASLNNIDYNSNECQAL 434
            +  +   R   PF + +            +      +        L  +DY+  ECQAL
Sbjct: 61  EKPSAIQQRGIVPFCKGLDV--------IQQAQSGTGKTATFCSGVLQQLDYSLVECQAL 112

Query: 435 VLAPTRELAQQIEKVMRALGDFLQVKCHACVGGTSVREDARILGAGVQVVVGTPGRVFDM 614
           VLAPTRELAQQIEKVMRALGD+L VK HACVGGTSVRED RIL +GV VVVGTPGRVFDM
Sbjct: 113 VLAPTRELAQQIEKVMRALGDYLGVKVHACVGGTSVREDQRILQSGVHVVVGTPGRVFDM 172

Query: 615 LRRRYLRADSIKMFTLDEADEMLSRGFKDQIYDIFQLLPPKLQVGVFSATLPPEALEITR 794
           LRR+ LR D IKMF LDEADEMLSRGFKDQIYDIFQLLPPK+QVGVFSAT+PPEALEITR
Sbjct: 173 LRRQSLRPDHIKMFVLDEADEMLSRGFKDQIYDIFQLLPPKIQVGVFSATMPPEALEITR 232

Query: 795 KFMNKPVRILVKRDELTLEGIKQFYVN 875
           KFM+KPVRILVKRDE+TLEGIKQFYVN
Sbjct: 233 KFMSKPVRILVKRDEVTLEGIKQFYVN 259

 Score = 94.7 bits (234), Expect = 4e-18
 Identities = 47/62 (75%), Positives = 52/62 (83%)
 Frame = +2

Query: 215 SFDQMNLHENLLAPAFTAYGFEKPSAIQSKGIVPFTKGLDVIQQAQSGTGKTATFCAGIA 394
           SFD M L ENLL   + AYGFEKPSAIQ +GIVPF KGLDVIQQAQSGTGKTATFC+G+ 
Sbjct: 41  SFDAMGLQENLLRGIY-AYGFEKPSAIQQRGIVPFCKGLDVIQQAQSGTGKTATFCSGVL 99

Query: 395 EQ 400
           +Q
Sbjct: 100 QQ 101



EST assemble image


clone accession position
1 HC065b07_r AV636854 1 609
2 LC080a08_r AV624603 1 636
3 LC055h07_r AV622876 18 696
4 LCL067h06_r AV629863 88 636
5 CM061e06_r AV390574 100 756
6 CM082b06_r AV392109 100 711
7 LCL043g05_r AV628559 103 682
8 LCL055b04_r AV629244 103 684
9 LC066d12_r AV623623 104 619
10 CM084d04_r AV392636 104 668
11 MX046b03_r BP087900 104 493
12 CM002a09_r AV397858 104 708
13 CM048f12_r AV389084 104 584
14 LC062b03_r AV623323 104 654
15 LC007c04_r AV619362 104 633
16 CM026a11_r AV387539 105 708
17 CM040b10_r AV389199 105 624
18 CM037b07_r AV388896 105 684
19 CM066a07_r AV390824 105 654
20 LCL085c11_r AV630859 106 497
21 HCL084e04_r AV644236 106 634
22 CM007d07_r AV386825 106 577
23 LCL018c07_r AV626931 106 636
24 CM096f04_r AV392781 107 590
25 CM009d10_r AV397666 107 779
26 MX045a08_r BP087856 107 518
27 HCL053e07_r AV642536 107 682
28 MX226a07_r BP090586 107 452
29 CM063e01_r AV390064 107 653
30 LCL076f10_r AV630285 107 498
31 CM036f06_r AV388823 107 447
32 LC018e10_r AV620171 107 496
33 LC069a05_r AV623813 107 661
34 HC028a08_r AV634007 107 658
35 CM024h03_r AV388276 107 778
36 LCL096c03_r AV631564 107 619
37 MX219f03_r BP090148 107 579
38 LCL014h08_r AV626755 107 360
39 LC079b03_r AV624536 107 653
40 HC033f04_r AV634457 107 654
41 LC074f11_r AV624225 107 650
42 LC070h06_r AV623951 107 610
43 HC012g08_r AV632803 107 388
44 HC001b06_r AV631874 107 646
45 HCL011d09_r AV640161 107 570
46 LC073h10_r AV624171 107 608
47 LC062g11_r AV623374 107 642
48 LCL060d04_r AV629530 107 567
49 LC071a02_r AV623957 107 637
50 HC075f12_r AV637640 107 603
51 LCL087g03_r AV631023 107 602
52 CL54c03_r AV396144 107 699
53 HC073g02_r AV637486 107 598
54 LCL049d02_r AV628944 107 407
55 MX217d04_r BP090009 107 424
56 HCL070b04_r AV643463 107 634
57 HCL043e12_r AV641995 107 685
58 LC036d04_r AV621455 107 671
59 LCL100f02_r AV631836 107 696
60 CM052a09_r AV390507 107 710
61 HC083a11_r AV638190 107 585
62 HC037c10_r AV634743 107 587
63 HC073c11_r AV637452 107 580
64 LCL092b07_r AV631333 107 397
65 CM031h11_r AV388335 108 311
66 CM037d07_r AV388899 108 702
67 MX237c07_r BP091345 108 539
68 MX239a10_r BP091456 108 443
69 MX235b06_r BP091189 108 580
70 LC042f12_r AV621925 108 646
71 CM020a12_r AV397509 108 726
72 CL64f01_r AV396612 108 678
73 CM050h08_r AV389755 108 460
74 HC083c04_r AV638205 109 679
75 HCL092a09_r AV644674 109 551
76 CM069d03_r AV391234 109 763
77 LCL055h06_r AV629285 110 606
78 HC083b01_r AV638192 111 480
79 HC091g01_r AV638857 111 619
80 HC099g08_r AV639471 111 637
81 MX235e02_r BP091213 112 387
82 CM073b03_r AV391397 112 770
83 HCL066d12_r AV643258 112 637
84 LCL011h05_r AV626585 112 387
85 HC003h07_r AV632097 112 675
86 MX037h07_r BP087580 112 662
87 HC037h08_r AV634790 112 593
88 MX226f01_r BP090621 112 594
89 LC053a10_r AV622687 112 670
90 LC069a01_r AV623809 113 611
91 MX067e04_r BP088733 113 489
92 LC071e04_r AV623994 113 670
93 LC014a02_r AV619846 113 678
94 LCL057f08_r AV629379 113 637
95 LC053g05_r AV622736 113 678
96 LC001b08_r AV618905 113 678
97 CM049a07_r AV389600 113 525
98 MX244a11_r BP091770 114 649
99 HC069b02_r AV637129 114 602
100 HC099a01_r AV639409 114 559
101 HCL014d03_r AV640330 114 438
102 HC094h04_r AV639090 114 615
103 HCL041f09_r AV641873 114 587
104 MX066h12_r BP088707 114 640
105 MX245g09_r BP091890 115 649
106 MX241g10_r BP091620 115 679
107 MXL067e07_r BP096949 115 549
108 HCL094c07_r AV644824 115 601
109 CM058g05_r AV390400 115 659
110 MX238b07_r BP091399 116 446
111 LC002e03_r AV619004 116 673
112 CM034e07_r AV388626 116 679
113 HC007b06_r AV632355 117 732
114 HC021g10_r AV633526 117 682
115 HC098d08_r AV639362 117 641
116 MX245d01_r BP091859 117 679
117 LC058d09_r AV623062 118 667
118 CM046b07_r AV388052 119 732
119 HC084b04_r AV638269 119 593
120 HCL019c08_r AV640618 119 424
121 HC031a05_r AV634248 119 652
122 HC095c03_r AV639121 119 626
123 MX233c02_r BP091063 121 555
124 HC086a09_r AV638412 121 637
125 LC041f02_r AV621840 121 682
126 HCL091g07_r AV644653 125 678
127 HCL092h02_r AV644721 129 504
128 CM071b03_r AV391314 130 596
129 CM044a07_r AV389564 130 713
130 CM007d03_r AV386801 130 682
131 MXL074b05_r BP097340 130 610
132 HC063a12_r AV636700 130 706
133 HC053e12_r AV635978 130 607
134 HCL070b07_r AV643466 137 653
135 CM085c07_r AV392364 138 637
136 CM008e12_r AV386742 141 711
137 HCL087g06_r AV644394 173 706
138 LC048e09_r AV622354 175 730
139 MXL094c11_r BP098502 176 555
140 CM092g07_r AV392695 176 676
141 CL31h02_r AV395027 178 740
142 CL38f06_r AV395313 188 760
143 CM096f12_r AV392793 225 744
144 MX251b05_r BP092213 232 803
145 LC064c10_r AV623476 233 880
146 CM020f07_r AV397508 235 889
147 HCL096g08_r AV397508 240 611
148 LCL077c05_r AV630324 261 841
149 LC089e09_r AV625226 282 825
150 HC001g08_r AV631926 286 808
151 MX260f06_r BP092902 290 824
152 CM083b09_r AV392183 301 541
153 CM076h11_r AV391670 309 949
154 CM100d02_r AV392824 310 756
155 HCL053e06_r AV642535 312 883
156 LC092a07_r AV625398 333 839
157 MXL032f07_r BP094925 338 869
158 MXL048b01_r BP095834 338 773
159 CM053b02_r AV389915 344 898
160 MXL092a05_r BP098351 355 558
161 MXL071a08_r BP097159 355 756
162 HC100f03_r AV639532 389 831
163 MX258h04_r BP092769 401 936
164 MX245d06_r BP091863 443 741
165 CM003f08_r AV386596 446 986
166 HC046b08_r AV635422 450 933
167 MXL012e05_r BP093717 453 877
168 CM040d07_r AV389168 465 934
169 CM066e02_r AV390845 475 1089
170 HC062c07_r AV636642 489 790
171 LC002g01_r AV619022 490 1036
172 HC043h09_r AV635255 503 1046
173 HC086c06_r AV638429 504 954
174 MX240c01_r BP091515 511 941
175 LC048g11_r AV622374 527 1036
176 CM002b05_r AV397855 532 1133
177 HC096c08_r AV639203 536 955
178 CM085c01_r AV392354 541 909
179 CM024a09_r AV388224 544 1153
180 CM059g03_r AV390686 548 1176
181 HC092d07_r AV638905 554 995
182 CM068f12_r AV391055 560 1199
183 LC074c09_r AV624199 569 1058
184 HCL041d01_r AV641851 570 1128
185 LC012e06_r AV619742 573 1135
186 LCL084g08_r AV630821 573 1081
187 LC093h08_r AV625511 581 970
188 CL26b10_r AV394621 582 1141
189 HC056d03_r AV636196 595 1037
190 HCL011e07_r AV640167 611 1076
191 CM064d12_r AV390997 630 1284
192 MX044b04_r BP087817 640 1003
193 LC051f12_r AV622594 640 1188
194 HC009e04_r AV632542 648 1182
195 CM027f04_r AV387617 670 1284
196 MX051f10_r BP088104 673 1136
197 CM024b06_r AV388281 683 1293
198 CM044b05_r AV389533 706 1266
199 LC033h05_r AV621286 710 1246
200 HC032f11_r AV634384 722 1269
201 HC032d01_r AV634355 738 1125
202 CM043g01_r AV389463 765 1063
203 CM020e02_r AV397490 773 1350
204 CM009g05_r AV397662 798 1409
205 CM074e02_r AV391513 805 1434
206 MX104e05_r BP089074 809 1170
207 LC009h10_r AV619554 817 1371
208 CM024c05_r AV388287 826 1417
209 CM016d05_r AV387480 831 1443
210 LCL016f12_r AV626852 835 1131
211 CM097h05_r AV393205 843 1340
212 CM070f01_r AV391268 850 1397
213 HC043a06_r AV635185 859 1457
214 LC021a05_r AV620357 860 1297
215 LC037d08_r AV621536 869 1409
216 LC021e10_r AV620392 869 1406
217 HC011f12_r AV632712 876 1343
218 CM051h12_r AV389869 884 1460
219 LCL026h05_r AV627446 885 1387
220 MX014d11_r BP086690 892 1368
221 HC039c02_r AV634882 893 1379
222 MX214a03_r BP089794 899 1223
223 HC068e05_r AV637085 903 1367
224 MX249e05_r BP092082 1013 1478
225 CM022f03_r AV387878 1085 1675
226 LC019d05_r AV620237 1167 1623
227 CL63b11_r AV396537 1230 1880
228 CM009f04_r AV397671 1241 1855
229 MX213b02_r BP089736 1328 1603
230 CL17e01_r AV394103 1331 1728
231 CL36g04_r AV395138 1340 1849
232 CL39h06_r AV395174 1360 1877
233 CL21g10_r AV394391 1372 1897
234 CL57d06_r AV396299 1397 1843
235 CM001h03_r AV386483 1435 1930
236 HCL093f01_r AV644776 1454 1896
237 LC043a12_r AV622105 1483 1943
238 CM043a09_r AV389467 1606 1897




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research