KCC000295A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000295A_C01 KCC000295A_c01
tGCAACATTACCAACAAGGCAAATGAAGTTTACGCACCAGCTGAAGTTTAATAGTGTGCC
GGAATGGAGAGAACACTACATACAGTATGGACATCTTAAGAAGTACATTTATGCGCTAGC
TAAGAAGGAAGCGGACCTTCAAGCTGGCGGCCAAGATGAGGAGGCGCTGCTCGCCCCGCT
GTTGGAAGCGGAGCGTGATCAGGGCCCCACGGAGGAGGGCTTCCAGCGGGAGTTAGACGC
GCAGCTTGCGGCCACGCTAAGCTTCTTCGCGGTGAAGGAGGCGGACCTGCTCGCCAAGGT
GTCCGCACTGGAGCTGGACATTCAAAGCCTGGAGAAGATCCCCAACCGCGCCGAGGCGTC
CACACTGGCGCGCATGGGCGGCAGCGCCAGCCCCGGCGGCCCCATGAGCAGCCCGCGCGC
CGCCGCCGCCGCCGCCATGTCGGCCATGGCCTCGCTGGTCAGCCACAGCCCCTCCACACT
GGACCTGGCGCGCATGGTCAACAGCACGCCGCCAGAGGACCACCGCAAGATCCGGGTCAA
GTTCTGGGAGAACCCGCCCCGCCACCTGTTCAGCACCAACCTCAACACGCGCAGGGCCAA
GCTGCAGGCGCGCTTCCAGGAGCTGTACATCTCGCTGCA


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000295A_C01 KCC000295A_c01
         (639 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|NP_596410.1| DASS transporter of unknown specificity [Schizo...    76  4e-13
emb|CAD21226.1| related to PHO87 protein [Neurospora crassa]           74  1e-12
ref|XP_327979.1| hypothetical protein [Neurospora crassa] gi|289...    74  1e-12
gb|AAO32576.1| PHO87 [Saccharomyces kluyveri]                          59  6e-08
emb|CAA96292.1| unnamed protein product [Saccharomyces cerevisiae]     58  1e-07

>ref|NP_596410.1| DASS transporter of unknown specificity [Schizosaccharomyces pombe]
           gi|7492736|pir||T40336 probable MSF transporter -
           fission yeast  (Schizosaccharomyces pombe)
           gi|2995339|emb|CAA18293.1| SPBC3B8.04c
           [Schizosaccharomyces pombe]
          Length = 867

 Score = 76.3 bits (186), Expect = 4e-13
 Identities = 43/132 (32%), Positives = 68/132 (50%), Gaps = 12/132 (9%)
 Frame = +2

Query: 23  MKFTHQLKFNSVPEWREHYIQYGHLKKYIYALAKKEADLQAGGQDEEALLAPLLEAERDQ 202
           MKF+H L+FN+VPEW E YI Y +LKK IY+L  ++  LQ G  DEE  L      E ++
Sbjct: 1   MKFSHSLQFNAVPEWSESYIAYSNLKKLIYSLEHEQITLQQGAPDEETRL-----LEHER 55

Query: 203 GPTEEGFQRELDAQLAATLSFFAVKEADLLAKVSALELDIQSLEK------------IPN 346
              ++ F   LD +L   + F+A KE ++  +   ++ + ++ E              P 
Sbjct: 56  RSPDDRFMFALDKELQGIVEFYAPKEKEIADQYGRIKGEFETYENEYMSQGNNINYPTPE 115

Query: 347 RAEASTLARMGG 382
           R + S+ +R  G
Sbjct: 116 RLQKSSASRKSG 127

>emb|CAD21226.1| related to PHO87 protein [Neurospora crassa]
          Length = 844

 Score = 74.3 bits (181), Expect = 1e-12
 Identities = 42/105 (40%), Positives = 61/105 (58%)
 Frame = +2

Query: 23  MKFTHQLKFNSVPEWREHYIQYGHLKKYIYALAKKEADLQAGGQDEEALLAPLLEAERDQ 202
           MKF+H ++FN+VP+W  HYI Y +LKK IY L +K   L +GG  E     PL++ E   
Sbjct: 1   MKFSHSIQFNAVPDWSTHYIAYSNLKKLIYQL-EKVIHLSSGGDGES---RPLIQHE--- 53

Query: 203 GPTEEGFQRELDAQLAATLSFFAVKEADLLAKVSALELDIQSLEK 337
              E  F R LD +L   LSF+ VKE +L  +V  +  D+ + ++
Sbjct: 54  -DPEIVFVRALDVELEKVLSFYTVKERELFEEVQNVLRDVDAFDE 97

>ref|XP_327979.1| hypothetical protein [Neurospora crassa] gi|28917298|gb|EAA27007.1|
           hypothetical protein [Neurospora crassa]
          Length = 1006

 Score = 74.3 bits (181), Expect = 1e-12
 Identities = 42/105 (40%), Positives = 61/105 (58%)
 Frame = +2

Query: 23  MKFTHQLKFNSVPEWREHYIQYGHLKKYIYALAKKEADLQAGGQDEEALLAPLLEAERDQ 202
           MKF+H ++FN+VP+W  HYI Y +LKK IY L +K   L +GG  E     PL++ E   
Sbjct: 161 MKFSHSIQFNAVPDWSTHYIAYSNLKKLIYQL-EKVIHLSSGGDGES---RPLIQHE--- 213

Query: 203 GPTEEGFQRELDAQLAATLSFFAVKEADLLAKVSALELDIQSLEK 337
              E  F R LD +L   LSF+ VKE +L  +V  +  D+ + ++
Sbjct: 214 -DPEIVFVRALDVELEKVLSFYTVKERELFEEVQNVLRDVDAFDE 257

>gb|AAO32576.1| PHO87 [Saccharomyces kluyveri]
          Length = 889

 Score = 58.9 bits (141), Expect = 6e-08
 Identities = 33/81 (40%), Positives = 45/81 (54%), Gaps = 14/81 (17%)
 Frame = +2

Query: 23  MKFTHQLKFNSVPEWREHYIQYGHLKKYIYALAKKEAD-LQAGGQDEEALLAPL------ 181
           MKF+H LK+N+VPEW++HY+ Y  LKK IY+L  +E   L  GGQ +   L  L      
Sbjct: 1   MKFSHSLKYNAVPEWQDHYLSYSQLKKLIYSLQARELQLLDDGGQLDRDRLKGLEGSSKA 60

Query: 182 -------LEAERDQGPTEEGF 223
                    ++RD+G  EE F
Sbjct: 61  LKKFKEKFMSKRDKGVGEEEF 81

>emb|CAA96292.1| unnamed protein product [Saccharomyces cerevisiae]
          Length = 293

 Score = 58.2 bits (139), Expect = 1e-07
 Identities = 40/112 (35%), Positives = 57/112 (50%), Gaps = 8/112 (7%)
 Frame = +2

Query: 23  MKFTHQLKFNSVPEWREHYIQYGHLKKYIYALAK-------KEADLQAGGQDEEALLAPL 181
           MKF+H L+FNSVPEW   Y+ Y  LKK IY+L K       K   ++    ++E L  PL
Sbjct: 1   MKFSHSLQFNSVPEWSTKYLAYSQLKKLIYSLQKDKLYSNNKHHVVEPHDANDENL--PL 58

Query: 182 L-EAERDQGPTEEGFQRELDAQLAATLSFFAVKEADLLAKVSALELDIQSLE 334
           L +A  D       F   L+ +L     F+  +E  L+A  + L+ D+  LE
Sbjct: 59  LADASPDDQFYISKFVAALNQELKKIDKFYISQETGLIANYNELKDDVMELE 110



EST assemble image


clone accession position
1 HCL010f04_r AV640112 1 248
2 HCL098f07_r AV645133 2 410
3 HCL055c05_r AV642643 69 550
4 CL17d05_r AV394107 132 639




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research