KCC000293A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000293A_C01 KCC000293A_c01
CTGCAATCCATTGAACCATTGCACTCGACCGAAGGAGCACTCGCAGCCGTCGCAGAAATG
GAGTTTCGCCGGTAGCGCAGAGCTTTTCCTGTTTTCTCTTTCAATTCTCCACTATACATC
CCACTGATTGCTCAGGATGAGTTCCCTGTTCGTGCAACCTGTTCAACTGTGCAAGAGCGG
CTCTGAGTCGGGAGGAGCCGGGTTTGTTCTCCAGCGCTGAATAAGTTCAAGAGCTGATGA
GCCGGCCGCGCCCTGTAGCTGTTGTGGATGCCTGTTCCAGCAAAAGGCAAAGCCTGCAGC
AAGAAGGGCTGGCAATGGAGGACAAGGCGCCCGCGAAGGGCTGGCATGCCGACGCCGGAA
CTTCTGCCGCTGCCGCTGCGCCCAAGGCTGCAGGCCAGTAAGCCCGCCAAGGGCGCTGAT
AAGCCAAAGGCGGCAGATGCAGCGGCTCCCGCCAGCAA


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000293A_C01 KCC000293A_c01
         (458 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

gb|AAG51340.1|AC012562_1 unknown protein; 28504-31237 [Arabidops...    36  0.18
ref|NP_187474.2| KH domain protein [Arabidopsis thaliana] gi|264...    36  0.18
gb|AAK49004.1| USC3-5p [Myxococcus xanthus]                            35  0.31
ref|NP_823727.1| putative translation initiation factor IF-2 [St...    35  0.52
dbj|BAC32669.1| unnamed protein product [Mus musculus]                 34  0.68

>gb|AAG51340.1|AC012562_1 unknown protein; 28504-31237 [Arabidopsis thaliana]
          Length = 319

 Score = 36.2 bits (82), Expect = 0.18
 Identities = 28/88 (31%), Positives = 38/88 (42%)
 Frame = -3

Query: 438 ICRLWLISALGGLTGLQPWAQRQRQKFRRRHASPSRAPCPPLPALLAAGFAFCWNRHPQQ 259
           IC   L   +  +TG+ P  Q      R RH SPS    P L + ++ G    WN  P +
Sbjct: 87  ICSRLLNQEIFRITGMMP-NQGFTDFDRLRHRSPSPMASPNLMSNVSGGGLGGWNGLPPE 145

Query: 258 LQGAAGSSALELIQRWRTNPAPPDSEPL 175
             G     A+E    W+  PA P S P+
Sbjct: 146 RIGGPHGMAME----WQGAPASPSSYPV 169

>ref|NP_187474.2| KH domain protein [Arabidopsis thaliana]
           gi|26449965|dbj|BAC42103.1| unknown protein [Arabidopsis
           thaliana]
          Length = 283

 Score = 36.2 bits (82), Expect = 0.18
 Identities = 28/88 (31%), Positives = 38/88 (42%)
 Frame = -3

Query: 438 ICRLWLISALGGLTGLQPWAQRQRQKFRRRHASPSRAPCPPLPALLAAGFAFCWNRHPQQ 259
           IC   L   +  +TG+ P  Q      R RH SPS    P L + ++ G    WN  P +
Sbjct: 51  ICSRLLNQEIFRITGMMP-NQGFTDFDRLRHRSPSPMASPNLMSNVSGGGLGGWNGLPPE 109

Query: 258 LQGAAGSSALELIQRWRTNPAPPDSEPL 175
             G     A+E    W+  PA P S P+
Sbjct: 110 RIGGPHGMAME----WQGAPASPSSYPV 133

>gb|AAK49004.1| USC3-5p [Myxococcus xanthus]
          Length = 575

 Score = 35.4 bits (80), Expect = 0.31
 Identities = 23/69 (33%), Positives = 29/69 (41%), Gaps = 1/69 (1%)
 Frame = -3

Query: 396 GLQPWAQRQRQKFR-RRHASPSRAPCPPLPALLAAGFAFCWNRHPQQLQGAAGSSALELI 220
           G   W  + R+  R RR + P R P PP P    A  A  W+RH Q              
Sbjct: 205 GRSSWPMQYRRARRVRRPSPPCRLPAPPGPCQRRAASAVRWHRHAQC-----------PA 253

Query: 219 QRWRTNPAP 193
           +RWR+  AP
Sbjct: 254 RRWRSRTAP 262

>ref|NP_823727.1| putative translation initiation factor IF-2 [Streptomyces
           avermitilis MA-4680] gi|29606199|dbj|BAC70262.1|
           putative translation initiation factor IF-2
           [Streptomyces avermitilis MA-4680]
          Length = 1046

 Score = 34.7 bits (78), Expect = 0.52
 Identities = 24/59 (40%), Positives = 31/59 (51%), Gaps = 2/59 (3%)
 Frame = +1

Query: 286 GKACSKKGWQWRTRRPRRAGMPTPELLPLPLRPRLQASKPAKGADKPKAAD--AAAPAS 456
           GKA  +K        P + G P+P     P  PR  A KPA  A++P AA+  AAAPA+
Sbjct: 56  GKAAPRKA------APAKPGAPSPAQAARPAAPRPPAPKPA-AAERPAAAERPAAAPAA 107

>dbj|BAC32669.1| unnamed protein product [Mus musculus]
          Length = 142

 Score = 34.3 bits (77), Expect = 0.68
 Identities = 22/63 (34%), Positives = 31/63 (48%), Gaps = 5/63 (7%)
 Frame = +2

Query: 281 QKAKPAARRAGNGGQGAREGLA---CRRRNFCRCRCAQGCRPVSPP--RALISQRRQMQR 445
           ++A+P  R+ G+GG G   G A    RRR         GC+P +PP  RA     R ++ 
Sbjct: 43  RRARPGTRKKGSGGGGGGGGGAGCLSRRRRI-------GCQPAAPPAGRAWTDSSRALEP 95

Query: 446 LPP 454
            PP
Sbjct: 96  RPP 98



EST assemble image


clone accession position
1 CL17g12_r AV394139 1 425
2 CL17d01_r AV394102 1 458




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research