KCC000292A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000292A_C01 KCC000292A_c01
cagcagcaaggcccggccaaggacgccgacggcgcaaacctgctgaacgtgatcaaccct
tatgagctgggccgacagacGCGCAAGGCGTTCGACGACGTGTGGGGCCAGCTCTCCCGT
GTGAGCTCGCCCACACGCAGCTTCATCATCGACGATGTCCTCGAGGTCGGGGTCGGGGCG
GACGCTGAGTTCGCGGCGCCGCAGGCCGCCTACACCACGGTGCTTGTGGTGGGAGCGACG
GGGCGCGTGGGGCGCATCCTGGTCCGCAAGCTGCTGCTGCGCGGCTACAAGGTGAAGGCG
CTGTTCCGCAACCGTGCCGGCGTGGGCAAGGACGCCATCCCAGACGCGGTGGAGGTTGTG
GAGGGCGATGTGGGAGACATGGCCACGTGCCAGAAGGCTGTGCAGGGCGTCAGCAAGGTG
ATCTTCTGCGCCGACGCGCGCTCCGTGTTCACGGCCGACCTGCTGCGCGTGGAGGACCGC
GGAGTCATGAACATGGTCAAGGCCATGCAGGATGAGCTG


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000292A_C01 KCC000292A_c01
         (519 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

pir||F86302 hypothetical protein F17F16.7 [imported] - Arabidops...   147  8e-35
ref|NP_173116.1| expressed protein [Arabidopsis thaliana] gi|170...   147  8e-35
gb|AAO72612.1| unknown [Oryza sativa (japonica cultivar-group)]       142  3e-33
ref|NP_600276.2| predicted nucleoside-diphosphate-sugar epimeras...    66  3e-10
ref|ZP_00007154.1| COG0449: Glucosamine 6-phosphate synthetase, ...    57  1e-07

>pir||F86302 hypothetical protein F17F16.7 [imported] - Arabidopsis thaliana
           gi|9954733|gb|AAG09086.1|AC026237_7 Unknown Protein
           [Arabidopsis thaliana]
          Length = 583

 Score =  147 bits (371), Expect = 8e-35
 Identities = 80/163 (49%), Positives = 107/163 (65%), Gaps = 6/163 (3%)
 Frame = +1

Query: 43  LNVINPYELGRQTRKAFDDVW------GQLSRVSSPTRSFIIDDVLEVGVGADAEFAAPQ 204
           L+ +NP  LGR++R+ FD+VW      GQ+SR + P     +D +L +  G   EFA P 
Sbjct: 92  LDDVNPVGLGRRSRQIFDEVWRKFSGLGQMSRTTRPDEQETLDSLL-IREGPMCEFAVPG 150

Query: 205 AAYTTVLVVGATGRVGRILVRKLLLRGYKVKALFRNRAGVGKDAIPDAVEVVEGDVGDMA 384
           A   TVLVVGAT R+GRI+VRKL+LRGY VKAL R +       +P +V++V GDVG+ +
Sbjct: 151 AQNVTVLVVGATSRIGRIVVRKLMLRGYTVKALVRKQDEEVMSMLPRSVDIVVGDVGEPS 210

Query: 385 TCQKAVQGVSKVIFCADARSVFTADLLRVEDRGVMNMVKAMQD 513
           T + AV+  SK+I+CA ARS  TADL RV+  GV N+ KA QD
Sbjct: 211 TLKSAVESCSKIIYCATARSTITADLTRVDHLGVYNLTKAFQD 253

>ref|NP_173116.1| expressed protein [Arabidopsis thaliana] gi|17065112|gb|AAL32710.1|
           Unknown protein [Arabidopsis thaliana]
           gi|22136090|gb|AAM91123.1| unknown protein [Arabidopsis
           thaliana]
          Length = 598

 Score =  147 bits (371), Expect = 8e-35
 Identities = 80/163 (49%), Positives = 107/163 (65%), Gaps = 6/163 (3%)
 Frame = +1

Query: 43  LNVINPYELGRQTRKAFDDVW------GQLSRVSSPTRSFIIDDVLEVGVGADAEFAAPQ 204
           L+ +NP  LGR++R+ FD+VW      GQ+SR + P     +D +L +  G   EFA P 
Sbjct: 101 LDDVNPVGLGRRSRQIFDEVWRKFSGLGQMSRTTRPDEQETLDSLL-IREGPMCEFAVPG 159

Query: 205 AAYTTVLVVGATGRVGRILVRKLLLRGYKVKALFRNRAGVGKDAIPDAVEVVEGDVGDMA 384
           A   TVLVVGAT R+GRI+VRKL+LRGY VKAL R +       +P +V++V GDVG+ +
Sbjct: 160 AQNVTVLVVGATSRIGRIVVRKLMLRGYTVKALVRKQDEEVMSMLPRSVDIVVGDVGEPS 219

Query: 385 TCQKAVQGVSKVIFCADARSVFTADLLRVEDRGVMNMVKAMQD 513
           T + AV+  SK+I+CA ARS  TADL RV+  GV N+ KA QD
Sbjct: 220 TLKSAVESCSKIIYCATARSTITADLTRVDHLGVYNLTKAFQD 262

>gb|AAO72612.1| unknown [Oryza sativa (japonica cultivar-group)]
          Length = 500

 Score =  142 bits (358), Expect = 3e-33
 Identities = 78/159 (49%), Positives = 107/159 (67%), Gaps = 5/159 (3%)
 Frame = +1

Query: 52  INPYELGRQTRKAFDDVWGQLSRV---SSPTRSFIIDDVLEVGV--GADAEFAAPQAAYT 216
           ++P  LGR++R+ FD+VW + SR+   SS + + + ++   V +  G   EF  P A  T
Sbjct: 7   VSPVGLGRRSRQIFDEVWRKFSRLGQMSSASSTALAEEEQAVLIRGGPMCEFTVPGAQDT 66

Query: 217 TVLVVGATGRVGRILVRKLLLRGYKVKALFRNRAGVGKDAIPDAVEVVEGDVGDMATCQK 396
           TVLVVGAT R+GRI+VRKL+LRGY VKAL R       D +P +V++V GDVGD +T + 
Sbjct: 67  TVLVVGATSRIGRIVVRKLMLRGYNVKALVRRNDAEVIDMLPRSVDIVVGDVGDPSTVKS 126

Query: 397 AVQGVSKVIFCADARSVFTADLLRVEDRGVMNMVKAMQD 513
           AV G SK+I+CA ARS  T DL RV+++GV N+ KA QD
Sbjct: 127 AVSGCSKIIYCATARSTITGDLNRVDNQGVRNVSKAFQD 165

>ref|NP_600276.2| predicted nucleoside-diphosphate-sugar epimerase [Corynebacterium
           glutamicum ATCC 13032] gi|21323817|dbj|BAB98443.1|
           Predicted nucleoside-diphosphate-sugar epimerases
           [Corynebacterium glutamicum ATCC 13032]
          Length = 218

 Score = 65.9 bits (159), Expect = 3e-10
 Identities = 38/98 (38%), Positives = 62/98 (62%)
 Frame = +1

Query: 217 TVLVVGATGRVGRILVRKLLLRGYKVKALFRNRAGVGKDAIPDAVEVVEGDVGDMATCQK 396
           TVLV+GATG +GR +V + L +GY+VKA  R+++      +P   E++ GD+ D ++ +K
Sbjct: 4   TVLVIGATGSIGRHVVSEALNQGYQVKAFVRSKSRA--RVLPAEAEIIVGDLLDPSSIEK 61

Query: 397 AVQGVSKVIFCADARSVFTADLLRVEDRGVMNMVKAMQ 510
           AV+GV  +IF     S   +D+  V+  GV N +KA++
Sbjct: 62  AVKGVEGIIF-THGTSTRKSDVRDVDYTGVANTLKAVK 98

>ref|ZP_00007154.1| COG0449: Glucosamine 6-phosphate synthetase, contains
           amidotransferase and phosphosugar isomerase domains
           [Rhodobacter sphaeroides]
          Length = 606

 Score = 57.4 bits (137), Expect = 1e-07
 Identities = 68/193 (35%), Positives = 75/193 (38%), Gaps = 27/193 (13%)
 Frame = +3

Query: 15  GQGRRRRKPAERDQPL*AGPTDAQGVRRRVGPALPCELAHTQLHHRRCPRGRGRGGR*VR 194
           G G  RR P  R          A  + RR+G      LA  +   RR PR RG G R  R
Sbjct: 77  GHGLHRRLPRCRG---------AHDLGRRLG------LADRRRRQRRGPRARG-GPRGGR 120

Query: 195 GAAGRLHHGACGG------SDGARGAHPGPQAAAARLQGEGAVPQPC-----RRG----Q 329
           GA  R H G          +  AR A P   A   RL G    P PC     RRG    +
Sbjct: 121 GARCRRHDGGSADPPDVCVAGPARPAAPRQHAGKPRLGGRDRRPCPCGLRCLRRGFPPGR 180

Query: 330 GRHPRRGGGCGGRCGRHGHVPEG-------CAGRQQGDLLRRRALR--VHGRPAARGG-- 476
            RHP  G G GG     GH P G       C GR+Q D L   AL      R AA GG  
Sbjct: 181 RRHPGGGRGAGGA----GHEPAGAGQHRLACGGRRQRDRLAAAALAGLRRRRRAAVGGAD 236

Query: 477 -PRSHEHGQGHAG 512
            P S +   G  G
Sbjct: 237 HPASLQRSSGRGG 249



EST assemble image


clone accession position
1 CL17a09_r AV394108 1 519
2 HCL024e08_r AV640910 179 432




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research