KCC000291A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000291A_C01 KCC000291A_c01
cacctcgcaatgaagcgtTACAGGTGCAGCCCCTAAATTGGTTAGCAGGGGGTCAAGTGC
ACGCCCTGGACTTCTTAACAGCAGTTCTGCACGCCGAGCTGATGACGTGCAGCCAATGTG
TGCCTTAGGCTTTTAGGGCAATCATAGGACTTTTCATTGAGTCGGCCGCGAGATCTGCAA
GGCATCCACACAATGCAGGCGGCGATGCACGCCCAGCGTCCAGCTGGGCCACCATGCTCT
AGCGCACCGTCGACATCATACCCCGTGGCACCTTCTCCGGTCAGCTCACGGAGCAGGGGC
CTGCATGCACGGAGAGGCGTGGCGGAGCAGAGGAGTTTGGGCTGCCGGAGCACTGGGAGC
AGCGATCAACACAGCAACACAAATGACGGGGCATCTGGGCCATCGCGTCCGGAGCAGGGT
CCCGAGTTGGACTGGAGCGGCCTCCCCCGTCGGCAGCTCGCGGCTATGGCCATGTCGCCC
TTCGCCGCTCTGTCGCTACCGCTGGTCAATGACCCGGCCTGGCAGCAGTCCTTCGAAACG
TACGGCGGGAAGCTGCGCGAAGTCCTGCTGGGGCAGCAGGAGGCTGCCAAGAACGTGGCG
AAGCAGCTGGATGAGGGGGTGACGTACATGGACTGGACGTACCGCAGCACGGGCGTGGAT
CTGAGCGCGGTGTGGGATCCGGAGCTGTGGATCCGGTTCCGGGAGGCGGTGGCGCAGAAC
GAGCCCGCCATCTTCTGGAACAAGCTGCTGGACCGGGTGCAGTACAA


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000291A_C01 KCC000291A_c01
         (767 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

ref|NP_767161.1| blr0521 [Bradyrhizobium japonicum] gi|27348769|...    53  5e-06
gb|AAK95470.1| LF3 [cercopithicine herpesvirus 15]                     50  4e-05
dbj|BAC87637.1| unnamed protein product [Homo sapiens]                 50  5e-05
gb|AAC82365.1| unknown [Myxococcus xanthus]                            49  9e-05
ref|ZP_00058982.1| COG0532: Translation initiation factor 2 (IF-...    49  9e-05

>ref|NP_767161.1| blr0521 [Bradyrhizobium japonicum] gi|27348769|dbj|BAC45786.1|
           blr0521 [Bradyrhizobium japonicum USDA 110]
          Length = 745

 Score = 53.1 bits (126), Expect = 5e-06
 Identities = 49/168 (29%), Positives = 58/168 (34%), Gaps = 3/168 (1%)
 Frame = -2

Query: 760 APGPAACSRRWRARSAPPPPGTGSTAPDPTPRSDPRPCCGTSSPCTSPPHPAASPRSWQP 581
           AP PAA   R  A   PPPP     AP P P     P   +  P  +P   A +P    P
Sbjct: 82  APPPAAAPPRPAAPPPPPPPPAARPAPPPPPPPPAAPKQPSPPPAAAPQQHAPTP----P 137

Query: 580 PAAPAGLRAASRRTFRRTAARPGH---*PAVATERRRATWP*PRAADGGGRSSPTRDPAP 410
           P AP   R A        AA P H    P     R   T P P  A    R +P     P
Sbjct: 138 PPAPPAARPAPTPPAPPPAAAPQHAPPPPPPPAARPTPTPPPPPPAGPAARPTPAPTATP 197

Query: 409 DAMAQMPRHLCCCVDRCSQCSGSPNSSAPPRLSVHAGPCSVS*PEKVP 266
             +A  P          +   GSP  +A P  +    P +   P   P
Sbjct: 198 TPVAPPPA-------APTARPGSPAPAATPAPTPTPAPTATPAPTATP 238

 Score = 46.6 bits (109), Expect = 4e-04
 Identities = 42/148 (28%), Positives = 51/148 (34%), Gaps = 25/148 (16%)
 Frame = -2

Query: 757 PGPAACSRRWRARSAPPPPGTGSTAPDPTPRSDPRPCC----------GTSSPCTSP--- 617
           P P   + R      PPPP   +  P P P + P P            G+ +P  +P   
Sbjct: 164 PPPPPPAARPTPTPPPPPPAGPAARPTPAPTATPTPVAPPPAAPTARPGSPAPAATPAPT 223

Query: 616 --PHPAASPRSWQPPA--APAGLRAASRRTFRRTAARPGH*PAVATERRRATWP*PRA-- 455
             P P A+P     PA  +  G   A R        RPG  PA  +       P P    
Sbjct: 224 PTPAPTATPAPTATPAPGSTPGAPPAGRPGAPPPGVRPGSPPAAGSPPAPGATPAPTTTP 283

Query: 454 ADGG------GRSSPTRDPAPDAMAQMP 389
           A GG      GR  P   PAP A    P
Sbjct: 284 APGGTATPPSGRPGPASTPAPGAATPAP 311

 Score = 43.1 bits (100), Expect = 0.005
 Identities = 40/126 (31%), Positives = 47/126 (36%), Gaps = 3/126 (2%)
 Frame = -2

Query: 751 PAACSRRWRARSAPPPPGTGSTAPDPTPRSDPRPCCGTSSPCT---SPPHPAASPRSWQP 581
           P A      AR A PPP     A  P P + P P      P      PP PAA P    P
Sbjct: 56  PGAAPPAAPARPAAPPPA----AAPPHPPAAPPPAAAPPRPAAPPPPPPPPAARPAPPPP 111

Query: 580 PAAPAGLRAASRRTFRRTAARPGH*PAVATERRRATWP*PRAADGGGRSSPTRDPAPDAM 401
           P  PA  +            +P   PA A ++   T P P  A    R +PT    P A 
Sbjct: 112 PPPPAAPK------------QPSPPPAAAPQQHAPTPPPP--APPAARPAPTPPAPPPAA 157

Query: 400 AQMPRH 383
           A  P+H
Sbjct: 158 A--PQH 161

 Score = 33.1 bits (74), Expect = 5.0
 Identities = 32/109 (29%), Positives = 38/109 (34%), Gaps = 3/109 (2%)
 Frame = -2

Query: 637 SSPCTSPPHPAASPRSWQPPAAPAGLRAASRRTFRRTAARPGH*PAV---ATERRRATWP 467
           + P   P  P   P    PPAAPA      R      AA P H PA    A    R   P
Sbjct: 42  TGPDGKPKQPPKGPPGAAPPAAPA------RPAAPPPAAAPPHPPAAPPPAAAPPRPAAP 95

Query: 466 *PRAADGGGRSSPTRDPAPDAMAQMPRHLCCCVDRCSQCSGSPNSSAPP 320
            P       R +P   P P A  + P        +  Q + +P   APP
Sbjct: 96  PPPPPPPAARPAPPPPPPPPAAPKQPSPPPAAAPQ--QHAPTPPPPAPP 142

 Score = 33.1 bits (74), Expect = 5.0
 Identities = 43/156 (27%), Positives = 51/156 (32%), Gaps = 1/156 (0%)
 Frame = -2

Query: 760 APGPAACSRRWRARSAPPPPG-TGSTAPDPTPRSDPRPCCGTSSPCTSPPHPAASPRSWQ 584
           AP P        A  +PP PG T +    P P     P  G   P ++P   AA+P    
Sbjct: 254 APPPGVRPGSPPAAGSPPAPGATPAPTTTPAPGGTATPPSGRPGPASTPAPGAATPAPTA 313

Query: 583 PPAAPAGLRAASRRTFRRTAARPGH*PAVATERRRATWP*PRAADGGGRSSPTRDPAPDA 404
            PA    L         R  A P   P   T    A      AA       P R PA  A
Sbjct: 314 TPAPGGALTPPP----GRPGAGPTPGPQGGTPPAGAPAAGTPAAPPQAGGLPAR-PAAPA 368

Query: 403 MAQMPRHLCCCVDRCSQCSGSPNSSAPPRLSVHAGP 296
            A  P          S   GS  ++ PP  +  A P
Sbjct: 369 GAAAP----------STVPGSAAATPPPNRAQFAPP 394

>gb|AAK95470.1| LF3 [cercopithicine herpesvirus 15]
          Length = 890

 Score = 50.1 bits (118), Expect = 4e-05
 Identities = 42/131 (32%), Positives = 53/131 (40%), Gaps = 6/131 (4%)
 Frame = -2

Query: 760 APGPAA-CSRRWRARSAPPPPGTGS-----TAPDPTPRSDPRPCCGTSSPCTSPPHPAAS 599
           APGP++   +R R R   PPP  GS       P P+ R+  R       P   PP   + 
Sbjct: 29  APGPSSRTGQRTRQRPGHPPPERGSGPRGTRPPAPSSRTGQRT---RQRPGHPPPERGSG 85

Query: 598 PRSWQPPAAPAGLRAASRRTFRRTAARPGH*PAVATERRRATWP*PRAADGGGRSSPTRD 419
           PR  +PP       A S RT +RT  RPGH P       R T P   ++  G R+     
Sbjct: 86  PRGTRPP-------APSSRTGQRTRQRPGHPPPERGSGPRGTRPPAPSSRTGQRTRQRPG 138

Query: 418 PAPDAMAQMPR 386
             P      PR
Sbjct: 139 HPPPERGSGPR 149

 Score = 46.2 bits (108), Expect = 6e-04
 Identities = 42/130 (32%), Positives = 50/130 (38%), Gaps = 8/130 (6%)
 Frame = -2

Query: 751 PAACSR---RWRARSAPPPPGTGS-----TAPDPTPRSDPRPCCGTSSPCTSPPHPAASP 596
           PA  SR   R R R   PPP  GS       P P+ R+  R       P   PP   + P
Sbjct: 278 PAPSSRTGQRTRQRPGHPPPERGSGPRGTRPPAPSSRTGQRT---RQRPGHPPPERGSGP 334

Query: 595 RSWQPPAAPAGLRAASRRTFRRTAARPGH*PAVATERRRATWP*PRAADGGGRSSPTRDP 416
           R  +PP       A S RT +RT  RPGH P       R T P   ++  G R+      
Sbjct: 335 RGTRPP-------APSSRTGQRTRQRPGHPPPERGSGPRGTRPPAPSSRTGQRTRQRPGH 387

Query: 415 APDAMAQMPR 386
            P      PR
Sbjct: 388 PPPERGSGPR 397

 Score = 46.2 bits (108), Expect = 6e-04
 Identities = 42/130 (32%), Positives = 50/130 (38%), Gaps = 8/130 (6%)
 Frame = -2

Query: 751 PAACSR---RWRARSAPPPPGTGS-----TAPDPTPRSDPRPCCGTSSPCTSPPHPAASP 596
           PA  SR   R R R   PPP  GS       P P+ R+  R       P   PP   + P
Sbjct: 402 PAPSSRTGQRTRQRPGHPPPERGSGPRGTRPPAPSSRTGQRT---RQRPGHPPPERGSGP 458

Query: 595 RSWQPPAAPAGLRAASRRTFRRTAARPGH*PAVATERRRATWP*PRAADGGGRSSPTRDP 416
           R  +PP       A S RT +RT  RPGH P       R T P   ++  G R+      
Sbjct: 459 RGTRPP-------APSSRTGQRTRQRPGHPPPERGSGPRGTRPPAPSSRTGQRTRQRPGH 511

Query: 415 APDAMAQMPR 386
            P      PR
Sbjct: 512 PPPERGSGPR 521

 Score = 46.2 bits (108), Expect = 6e-04
 Identities = 42/130 (32%), Positives = 50/130 (38%), Gaps = 8/130 (6%)
 Frame = -2

Query: 751 PAACSR---RWRARSAPPPPGTGS-----TAPDPTPRSDPRPCCGTSSPCTSPPHPAASP 596
           PA  SR   R R R   PPP  GS       P P+ R+  R       P   PP   + P
Sbjct: 216 PAPSSRTGQRTRQRPGHPPPERGSGPRGTRPPAPSSRTGQRT---RQRPGHPPPERGSGP 272

Query: 595 RSWQPPAAPAGLRAASRRTFRRTAARPGH*PAVATERRRATWP*PRAADGGGRSSPTRDP 416
           R  +PP       A S RT +RT  RPGH P       R T P   ++  G R+      
Sbjct: 273 RGTRPP-------APSSRTGQRTRQRPGHPPPERGSGPRGTRPPAPSSRTGQRTRQRPGH 325

Query: 415 APDAMAQMPR 386
            P      PR
Sbjct: 326 PPPERGSGPR 335

 Score = 46.2 bits (108), Expect = 6e-04
 Identities = 42/130 (32%), Positives = 50/130 (38%), Gaps = 8/130 (6%)
 Frame = -2

Query: 751 PAACSR---RWRARSAPPPPGTGS-----TAPDPTPRSDPRPCCGTSSPCTSPPHPAASP 596
           PA  SR   R R R   PPP  GS       P P+ R+  R       P   PP   + P
Sbjct: 619 PAPSSRTGQRTRQRPGHPPPERGSGPRGTRPPAPSSRTGQRT---RQRPGHPPPERGSGP 675

Query: 595 RSWQPPAAPAGLRAASRRTFRRTAARPGH*PAVATERRRATWP*PRAADGGGRSSPTRDP 416
           R  +PP       A S RT +RT  RPGH P       R T P   ++  G R+      
Sbjct: 676 RGTRPP-------APSSRTGQRTRQRPGHPPPERGSGPRGTRPPAPSSRTGQRTRQRPGH 728

Query: 415 APDAMAQMPR 386
            P      PR
Sbjct: 729 PPPERGSGPR 738

 Score = 46.2 bits (108), Expect = 6e-04
 Identities = 42/130 (32%), Positives = 50/130 (38%), Gaps = 8/130 (6%)
 Frame = -2

Query: 751 PAACSR---RWRARSAPPPPGTGS-----TAPDPTPRSDPRPCCGTSSPCTSPPHPAASP 596
           PA  SR   R R R   PPP  GS       P P+ R+  R       P   PP   + P
Sbjct: 123 PAPSSRTGQRTRQRPGHPPPERGSGPRGTRPPAPSSRTGQRT---RQRPGHPPPERGSGP 179

Query: 595 RSWQPPAAPAGLRAASRRTFRRTAARPGH*PAVATERRRATWP*PRAADGGGRSSPTRDP 416
           R  +PP       A S RT +RT  RPGH P       R T P   ++  G R+      
Sbjct: 180 RGTRPP-------APSSRTGQRTRQRPGHPPPERGSGPRGTRPPAPSSRTGQRTRQRPGH 232

Query: 415 APDAMAQMPR 386
            P      PR
Sbjct: 233 PPPERGSGPR 242

 Score = 46.2 bits (108), Expect = 6e-04
 Identities = 42/130 (32%), Positives = 50/130 (38%), Gaps = 8/130 (6%)
 Frame = -2

Query: 751 PAACSR---RWRARSAPPPPGTGS-----TAPDPTPRSDPRPCCGTSSPCTSPPHPAASP 596
           PA  SR   R R R   PPP  GS       P P+ R+  R       P   PP   + P
Sbjct: 185 PAPSSRTGQRTRQRPGHPPPERGSGPRGTRPPAPSSRTGQRT---RQRPGHPPPERGSGP 241

Query: 595 RSWQPPAAPAGLRAASRRTFRRTAARPGH*PAVATERRRATWP*PRAADGGGRSSPTRDP 416
           R  +PP       A S RT +RT  RPGH P       R T P   ++  G R+      
Sbjct: 242 RGTRPP-------APSSRTGQRTRQRPGHPPPERGSGPRGTRPPAPSSRTGQRTRQRPGH 294

Query: 415 APDAMAQMPR 386
            P      PR
Sbjct: 295 PPPERGSGPR 304

 Score = 46.2 bits (108), Expect = 6e-04
 Identities = 42/130 (32%), Positives = 50/130 (38%), Gaps = 8/130 (6%)
 Frame = -2

Query: 751 PAACSR---RWRARSAPPPPGTGS-----TAPDPTPRSDPRPCCGTSSPCTSPPHPAASP 596
           PA  SR   R R R   PPP  GS       P P+ R+  R       P   PP   + P
Sbjct: 433 PAPSSRTGQRTRQRPGHPPPERGSGPRGTRPPAPSSRTGQRT---RQRPGHPPPERGSGP 489

Query: 595 RSWQPPAAPAGLRAASRRTFRRTAARPGH*PAVATERRRATWP*PRAADGGGRSSPTRDP 416
           R  +PP       A S RT +RT  RPGH P       R T P   ++  G R+      
Sbjct: 490 RGTRPP-------APSSRTGQRTRQRPGHPPPERGSGPRGTRPPAPSSRTGQRTRQRPGH 542

Query: 415 APDAMAQMPR 386
            P      PR
Sbjct: 543 PPPERGSGPR 552

 Score = 46.2 bits (108), Expect = 6e-04
 Identities = 42/130 (32%), Positives = 50/130 (38%), Gaps = 8/130 (6%)
 Frame = -2

Query: 751 PAACSR---RWRARSAPPPPGTGS-----TAPDPTPRSDPRPCCGTSSPCTSPPHPAASP 596
           PA  SR   R R R   PPP  GS       P P+ R+  R       P   PP   + P
Sbjct: 495 PAPSSRTGQRTRQRPGHPPPERGSGPRGTRPPAPSSRTGQRT---RQRPGHPPPERGSGP 551

Query: 595 RSWQPPAAPAGLRAASRRTFRRTAARPGH*PAVATERRRATWP*PRAADGGGRSSPTRDP 416
           R  +PP       A S RT +RT  RPGH P       R T P   ++  G R+      
Sbjct: 552 RGTRPP-------APSSRTGQRTRQRPGHPPPERGSGPRGTRPPAPSSRTGQRTRQRPGH 604

Query: 415 APDAMAQMPR 386
            P      PR
Sbjct: 605 PPPERGSGPR 614

 Score = 46.2 bits (108), Expect = 6e-04
 Identities = 42/130 (32%), Positives = 50/130 (38%), Gaps = 8/130 (6%)
 Frame = -2

Query: 751 PAACSR---RWRARSAPPPPGTGS-----TAPDPTPRSDPRPCCGTSSPCTSPPHPAASP 596
           PA  SR   R R R   PPP  GS       P P+ R+  R       P   PP   + P
Sbjct: 557 PAPSSRTGQRTRQRPGHPPPERGSGPRGTRPPAPSSRTGQRT---RQRPGHPPPERGSGP 613

Query: 595 RSWQPPAAPAGLRAASRRTFRRTAARPGH*PAVATERRRATWP*PRAADGGGRSSPTRDP 416
           R  +PP       A S RT +RT  RPGH P       R T P   ++  G R+      
Sbjct: 614 RGTRPP-------APSSRTGQRTRQRPGHPPPERGSGPRGTRPPAPSSRTGQRTRQRPGH 666

Query: 415 APDAMAQMPR 386
            P      PR
Sbjct: 667 PPPERGSGPR 676

 Score = 46.2 bits (108), Expect = 6e-04
 Identities = 42/130 (32%), Positives = 50/130 (38%), Gaps = 8/130 (6%)
 Frame = -2

Query: 751 PAACSR---RWRARSAPPPPGTGS-----TAPDPTPRSDPRPCCGTSSPCTSPPHPAASP 596
           PA  SR   R R R   PPP  GS       P P+ R+  R       P   PP   + P
Sbjct: 61  PAPSSRTGQRTRQRPGHPPPERGSGPRGTRPPAPSSRTGQRT---RQRPGHPPPERGSGP 117

Query: 595 RSWQPPAAPAGLRAASRRTFRRTAARPGH*PAVATERRRATWP*PRAADGGGRSSPTRDP 416
           R  +PP       A S RT +RT  RPGH P       R T P   ++  G R+      
Sbjct: 118 RGTRPP-------APSSRTGQRTRQRPGHPPPERGSGPRGTRPPAPSSRTGQRTRQRPGH 170

Query: 415 APDAMAQMPR 386
            P      PR
Sbjct: 171 PPPERGSGPR 180

 Score = 46.2 bits (108), Expect = 6e-04
 Identities = 42/130 (32%), Positives = 50/130 (38%), Gaps = 8/130 (6%)
 Frame = -2

Query: 751  PAACSR---RWRARSAPPPPGTGS-----TAPDPTPRSDPRPCCGTSSPCTSPPHPAASP 596
            PA  SR   R R R   PPP  GS       P P+ R+  R       P   PP   + P
Sbjct: 681  PAPSSRTGQRTRQRPGHPPPERGSGPRGTRPPAPSSRTGQRT---RQRPGHPPPERGSGP 737

Query: 595  RSWQPPAAPAGLRAASRRTFRRTAARPGH*PAVATERRRATWP*PRAADGGGRSSPTRDP 416
            R  +PP       A S RT +RT  RPGH P       R T P   ++  G R+      
Sbjct: 738  RGTRPP-------APSSRTGQRTRQRPGHPPPERGSGPRGTRPPAPSSRTGQRTRQRPGH 790

Query: 415  APDAMAQMPR 386
             P      PR
Sbjct: 791  PPPERGSGPR 800

 Score = 46.2 bits (108), Expect = 6e-04
 Identities = 42/130 (32%), Positives = 50/130 (38%), Gaps = 8/130 (6%)
 Frame = -2

Query: 751 PAACSR---RWRARSAPPPPGTGS-----TAPDPTPRSDPRPCCGTSSPCTSPPHPAASP 596
           PA  SR   R R R   PPP  GS       P P+ R+  R       P   PP   + P
Sbjct: 340 PAPSSRTGQRTRQRPGHPPPERGSGPRGTRPPAPSSRTGQRT---RQRPGHPPPERGSGP 396

Query: 595 RSWQPPAAPAGLRAASRRTFRRTAARPGH*PAVATERRRATWP*PRAADGGGRSSPTRDP 416
           R  +PP       A S RT +RT  RPGH P       R T P   ++  G R+      
Sbjct: 397 RGTRPP-------APSSRTGQRTRQRPGHPPPERGSGPRGTRPPAPSSRTGQRTRQRPGH 449

Query: 415 APDAMAQMPR 386
            P      PR
Sbjct: 450 PPPERGSGPR 459

 Score = 45.1 bits (105), Expect = 0.001
 Identities = 41/127 (32%), Positives = 49/127 (38%), Gaps = 8/127 (6%)
 Frame = -2

Query: 751  PAACSR---RWRARSAPPPPGTGS-----TAPDPTPRSDPRPCCGTSSPCTSPPHPAASP 596
            PA  SR   R R R   PPP  GS       P P+ R+  R       P   PP   + P
Sbjct: 743  PAPSSRTGQRTRQRPGHPPPERGSGPRGTRPPAPSSRTGQRT---RQRPGHPPPERGSGP 799

Query: 595  RSWQPPAAPAGLRAASRRTFRRTAARPGH*PAVATERRRATWP*PRAADGGGRSSPTRDP 416
            R  +PP       A S RT +RT  RPGH P       R T P   ++  G R+      
Sbjct: 800  RGTRPP-------APSSRTGQRTRQRPGHPPPERGSGPRGTRPPAPSSRTGQRTRQRPGH 852

Query: 415  APDAMAQ 395
             P    Q
Sbjct: 853  PPPEQTQ 859

>dbj|BAC87637.1| unnamed protein product [Homo sapiens]
          Length = 286

 Score = 49.7 bits (117), Expect = 5e-05
 Identities = 56/169 (33%), Positives = 71/169 (41%), Gaps = 13/169 (7%)
 Frame = -2

Query: 751 PAACSRRWRARSAPP-PPGTGSTAPDPTPRSDPRPCCGTSSPCTSPPH-------PAASP 596
           P A   R   R++P   P T S    P PR+ PR     +SP  +PP        P ASP
Sbjct: 122 PRASPTRTPPRASPRRTPSTASPTRTP-PRASPRRTPPRASPTRTPPRASPKRTPPRASP 180

Query: 595 RSWQPPAAPAGLRAASRRTFRRT--AARPGH*PAVATERRRATWP*PRAADGGGRSSPTR 422
           R   P A+P   RA  R + +RT   A P   P  A+  R  T P    A    R+SPTR
Sbjct: 181 RRTPPRASPT--RAPPRASPKRTPPTASPTRTPPRASPTR--TPPTESPARTPPRASPTR 236

Query: 421 DPAPDAMAQMPRHLCCCVDRCSQCSGSPNSS---APPRLSVHAGPCSVS 284
            P  ++ A+ P        R S     P +S    PPR S    P + S
Sbjct: 237 TPPTESPARTP-------SRASTRRTPPRASPTRTPPRASPKRTPPTAS 278

 Score = 43.9 bits (102), Expect = 0.003
 Identities = 48/166 (28%), Positives = 63/166 (37%), Gaps = 3/166 (1%)
 Frame = -2

Query: 751 PAACSRRWRARSAPPPPGTGSTAPDPTPRSDPRPCCGTSSPCTSPPHPAASPRSWQPPAA 572
           P A  RR   R++   P T +      P + P     T+SP  +P  P  SP    P A+
Sbjct: 59  PRASPRRTPPRASLTRPPTRAPPTRMPPTAPPTRTPPTASPARTP--PTESPARTPPTAS 116

Query: 571 PAGLRAASRRTFRRTAARPGH*PAVATERRRATWP*PRAADGGGRSSPTRDPAPDAMAQM 392
           PA     +  T     A P   P+ A+  R      PR      R+SPTR P   +  + 
Sbjct: 117 PARTPPRASPTRTPPRASPRRTPSTASPTRTPPRASPRRTP--PRASPTRTPPRASPKRT 174

Query: 391 PRHLCCCVDRCSQCSGSPNSS---APPRLSVHAGPCSVS*PEKVPR 263
           P        R S     P +S   APPR S    P + S     PR
Sbjct: 175 P-------PRASPRRTPPRASPTRAPPRASPKRTPPTASPTRTPPR 213

 Score = 42.0 bits (97), Expect = 0.011
 Identities = 39/130 (30%), Positives = 54/130 (41%), Gaps = 3/130 (2%)
 Frame = -2

Query: 763 TAPGPAACSRRWRARSAP---PPPGTGSTAPDPTPRSDPRPCCGTSSPCTSPPHPAASPR 593
           T   P A  +R   R++P   PP  + + AP   PR+ P+    T+SP  +PP   ASP 
Sbjct: 163 TRTPPRASPKRTPPRASPRRTPPRASPTRAP---PRASPKRTPPTASPTRTPPR--ASPT 217

Query: 592 SWQPPAAPAGLRAASRRTFRRTAARPGH*PAVATERRRATWP*PRAADGGGRSSPTRDPA 413
              P  +PA     +  T       P   P+ A+ RR  T P         R+SP R P 
Sbjct: 218 RTPPTESPARTPPRASPTRTPPTESPARTPSRASTRR--TPPRASPTRTPPRASPKRTPP 275

Query: 412 PDAMAQMPRH 383
             +     RH
Sbjct: 276 TASPTSCIRH 285

 Score = 40.0 bits (92), Expect = 0.041
 Identities = 46/173 (26%), Positives = 54/173 (30%), Gaps = 6/173 (3%)
 Frame = -2

Query: 763 TAPGPAACSRRWRARSAPPPPGTGSTAPDPTPRSDPRPCCGTSSPCTSPP---HPAASPR 593
           T   P     R      PP      T P  +PR  P     T  P  +PP    P A P 
Sbjct: 32  TRASPTRMPPRASPTRTPPRASPRRTPPRASPRRTPPRASLTRPPTRAPPTRMPPTAPPT 91

Query: 592 SWQPPAAPAGLRAASRRTFRRTAARPGH*PAVATERRRATWP*PRAADGGGRSSPTRDPA 413
              P A+PA              A P   P  A+  R      PR       +SPTR P 
Sbjct: 92  RTPPTASPARTPPTESPARTPPTASPARTPPRASPTRTPPRASPRRTP--STASPTRTPP 149

Query: 412 PDAMAQMPRHLCCCVDRCSQCSGSPNSS---APPRLSVHAGPCSVS*PEKVPR 263
             +  + P        R S     P +S    PPR S    P   S     PR
Sbjct: 150 RASPRRTP-------PRASPTRTPPRASPKRTPPRASPRRTPPRASPTRAPPR 195

>gb|AAC82365.1| unknown [Myxococcus xanthus]
          Length = 542

 Score = 48.9 bits (115), Expect = 9e-05
 Identities = 53/178 (29%), Positives = 67/178 (36%), Gaps = 22/178 (12%)
 Frame = -2

Query: 757 PGPAACSRRWRARSAPPPPGTGSTAPDPTPRSDPRPCCGTSSPCTSPP---HPAASPRSW 587
           P P   S R    + PPP  T S    P P++ P PC   + P + PP   H  +  RS+
Sbjct: 21  PPPCLLSERTPPGARPPPTETASY---PPPQAVPGPCAPRAPPRSPPPRRRHRGSRHRSF 77

Query: 586 QPPAAPAGLR--AASRRTFRRTAARPGH--------------*PAVATERRRATWP*PRA 455
           +P  A    R   A  R  RR  A P                 P  A  R RA    P  
Sbjct: 78  RPTCARRSGRRCPAPSRHARRNPAGPSRRCGPPRKSTPTRCCTPCPAPPRCRARPSAP-- 135

Query: 454 ADGGGRSSPTRDPAPDAMAQMPRHLCCCVDRCSQCSG-SPNSS--APPRLSVHAGPCS 290
           A   GR+ PT  P+  A        CC   RC    G +P+ +  +PP  S    P S
Sbjct: 136 APSAGRTCPTAGPSSCASG------CCPTGRCGSAPGPTPHGAEPSPPSQSPSPAPAS 187

 Score = 48.5 bits (114), Expect = 1e-04
 Identities = 50/159 (31%), Positives = 59/159 (36%), Gaps = 10/159 (6%)
 Frame = -2

Query: 766 CTAPGPAACSRRWRARSAPPPPGTGSTAPDPTPRSDPRPCCGTSSPCTSPPHPAASPRSW 587
           C  P PA    R RAR + P P  G T P   P S    CC T   C S P P       
Sbjct: 118 CCTPCPAP--PRCRARPSAPAPSAGRTCPTAGPSSCASGCCPTGR-CGSAPGPTPHGAEP 174

Query: 586 QPPAAPAGLRAASRRTFRRTAARPGH*PAVATERRRATWP*PRA----ADGGGRSSP--- 428
            PP+       AS    RRT  RP    + A     A  P PR       G  R++P   
Sbjct: 175 SPPSQSPSPAPASSGGRRRTHPRPAR-ASAAGATAPACLPPPRCCGRPGTGCARTAPPST 233

Query: 427 --TRDPAPDAMAQMPRHLCCCVDRCSQCSGSPNSS-APP 320
             +  P P +    PR            SGSP ++ APP
Sbjct: 234 SASHPPPPRSPGTPPR-----------ASGSPAAAPAPP 261

 Score = 44.7 bits (104), Expect = 0.002
 Identities = 63/230 (27%), Positives = 83/230 (35%), Gaps = 15/230 (6%)
 Frame = -2

Query: 742 CSRRWRARSAPPP-------PGTGSTAPDPTPRSDPRPCCGTSSPCTSPPH-------PA 605
           C+RR   R  P P       P   S    P  +S P  CC   +PC +PP        PA
Sbjct: 81  CARR-SGRRCPAPSRHARRNPAGPSRRCGPPRKSTPTRCC---TPCPAPPRCRARPSAPA 136

Query: 604 ASPRSWQPPAAPAGLRAASRRTFRRTAARPGH*PAVATERRRATWP*PRAADGGGRSSPT 425
            S     P A P+   +    T R  +A PG  P  A     +  P P  A  GGR    
Sbjct: 137 PSAGRTCPTAGPSSCASGCCPTGRCGSA-PGPTPHGAEPSPPSQSPSPAPASSGGRRRTH 195

Query: 424 RDPAPDAMAQMPRHLCCCVDRCSQCSGSPNS-SAPPRLSVHAGPCSVS*PEKVPRGMMST 248
             PA  + A      C    RC    G+  + +APP  S    P   S P   PR   S 
Sbjct: 196 PRPARASAAGATAPACLPPPRCCGRPGTGCARTAPPSTSASHPPPPRS-PGTPPRASGSP 254

Query: 247 VR*SMVAQLDAGRASPPALCGCLADLAADSMKSPMIALKA*GTHWLHVIS 98
              +      A R  PP       + A  ++  P I+       WLH+++
Sbjct: 255 AA-APAPPSPACRPPPPGTTPAPRNAALPAL--PCISPSRQRATWLHLLA 301

 Score = 35.0 bits (79), Expect = 1.3
 Identities = 33/104 (31%), Positives = 42/104 (39%), Gaps = 5/104 (4%)
 Frame = -2

Query: 766 CTAPGPAACSRRW---RARSAPPPPGTGSTAP--DPTPRSDPRPCCGTSSPCTSPPHPAA 602
           C  PG   C+R      + S PPPP +  T P    +P + P P     SP   PP P  
Sbjct: 218 CGRPG-TGCARTAPPSTSASHPPPPRSPGTPPRASGSPAAAPAP----PSPACRPPPPGT 272

Query: 601 SPRSWQPPAAPAGLRAASRRTFRRTAARPGH*PAVATERRRATW 470
           +P       AP            R AA P   P ++  R+RATW
Sbjct: 273 TP-------AP------------RNAALPAL-PCISPSRQRATW 296

 Score = 33.9 bits (76), Expect = 2.9
 Identities = 25/76 (32%), Positives = 28/76 (35%), Gaps = 7/76 (9%)
 Frame = -2

Query: 718 SAPPPPGTGSTAPDPTPRSDPRPCCGTSSPCTSPP-------HPAASPRSWQPPAAPAGL 560
           +AP PP      P P     PR     + PC SP        H  A P+  Q      GL
Sbjct: 256 AAPAPPSPACRPPPPGTTPAPRNAALPALPCISPSRQRATWLHLLAQPQDGQATFKGHGL 315

Query: 559 RAASRRTFRRTAARPG 512
           RA  R   RR   R G
Sbjct: 316 RARVRTGRRRHLHRLG 331

 Score = 33.1 bits (74), Expect = 5.0
 Identities = 29/98 (29%), Positives = 34/98 (34%), Gaps = 12/98 (12%)
 Frame = +2

Query: 341 AAGALGAAINTATQMTGHLGHRVRSRVPSWTGAASPV------------GSSRLWPCRPS 484
           AAGA   A     +  G  G       P  T A+ P             GS    P  PS
Sbjct: 203 AAGATAPACLPPPRCCGRPGTGCARTAPPSTSASHPPPPRSPGTPPRASGSPAAAPAPPS 262

Query: 485 PLCRYRWSMTRPGSSPSKRTAGSCAKSCWGSRRLPRTW 598
           P CR       PG++P+ R A   A  C    R   TW
Sbjct: 263 PACR----PPPPGTTPAPRNAALPALPCISPSRQRATW 296

>ref|ZP_00058982.1| COG0532: Translation initiation factor 2 (IF-2; GTPase)
           [Thermobifida fusca]
          Length = 955

 Score = 48.9 bits (115), Expect = 9e-05
 Identities = 43/146 (29%), Positives = 51/146 (34%), Gaps = 4/146 (2%)
 Frame = -2

Query: 721 RSAPPPPGTG-STAPDPTPRSDPRPCCGTSSPCTSPPHPAASPRSWQPPAAPAGLRAASR 545
           R A P PG G    P P P+  PRP           P   A     QP  A    R  S 
Sbjct: 94  RPAVPKPGPGLKPGPRPVPKPGPRP--------GPRPEGGAGKAGQQPSGAQGPARPESG 145

Query: 544 RTFR---RTAARPGH*PAVATERRRATWP*PRAADGGGRSSPTRDPAPDAMAQMPRHLCC 374
           +T R   +   RPG+ P  +T     T P PR    GG  +P   P P      PR    
Sbjct: 146 KTPRPVPKPGPRPGNNPFSSTASGMGTRPTPRPPASGGTGAPRPGPRPHPGMMPPR---- 201

Query: 373 CVDRCSQCSGSPNSSAPPRLSVHAGP 296
                +   G P   AP   +   GP
Sbjct: 202 ---PGASAGGPPRPQAPRPQAPRPGP 224



EST assemble image


clone accession position
1 CL16h04_r AV394012 1 507
2 HCL075e05_r AV643759 19 409
3 HCL057h05_r AV642784 24 544
4 MXL021f04_r BP094348 26 372
5 MXL065e02_r BP096823 74 532
6 LCL005h01_r AV626287 261 767




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research