KCC000290A_c01
[Fasta Sequence]   [Nr Search]   [EST assemble image]  

Fasta Sequence
>KCC000290A_C01 KCC000290A_c01
CCGAACACGGACCACACTCACCTGGCAACAATGGCCCTTACCATGAAGCGCTCGGGCGTG
GCCGCTCGCTCGGCCTCCTCCCGCAAGTCGGTGGTGACCTGCGTCGCTCGCCAGTCGTGG
CTGCCGGGCAGCCAGATCCCCGCCCACCTGGACACCCCCGCTGCTCAGGCGCTGGCTGGC
AACTTCGGCTTCGACCCCCTGGGCCTGGGCAAGGACCCCGTGGCTCTGCGCTGGTACCAG
CAGGCTGAGCTGATCCACTGCCGCACTGCCATGGCTGGTGTTGCCGGTATCCTGATCCCC
GGCCTGCTGACCAAGGGCTGGGCGCCCTGAACGTGCCTGAGTGGTACGACGCCGGCAAGG
TGGCGATCGAGAACTCGTTCGCTCCCTGGGGCTCTCTGCTGGCTGTGCAGCTGTTCCTGT
GCGGCTTCGTGGAGGCCAAGCGCTGGCAGGACATCCGCAAGCCCGGCAGCCAGTGCGAGC
CTGGCTCGTTCCTGTGCTTCGAGGCGTCCCTGAAGGGCACCTCGGAGCTGGGCTACCCCG
GCGGCCCCTTCGACCCCCTTGGCCTGTCCAAGGGAGGCCGACAAGTGGGCTGACTGGAAG
CTGAAGGAGGTCAAGAACGGCCGCCTGGCCATGCTGGCCTTCCTGGGCTTCGTTGCCCAG
AAGTACGCCACCGGCGCCGGCCCCGTGGACAACCTGGCTGCCCACCTGAAGGACCCCTGG
CACGTGAACTACGCCACCAACGGCGTCTCCCTGCCCTTCCTGTAAATGCCCGGTTGCATG
CGCCTGACCCGTCCTGGCGGCCTGGGCCTAGTATAGAGCTAGCGCTGACAGAGACGATGT
GAGCGGCGTTGTAATTTTAGGGACTCCTAGAGAAGAAGAGACAAACGTGTCGCGTGTTAA
AGTCTTTGGGTTGGGTTGGGGCGATTCTCCTGCGTTGCGCAGCACTGGTTTTCGAGGGCT
CACACACTGCACGCTACCCGCACAATGGTCGGCAATTTTCGGGGTTTTTCATGCCTGCCG
CGGGAGCCTGCCGGTCCTCCTGTAACCTGGCTGTGATCAAA


Nr search


BLASTX 2.2.2 [Dec-14-2001]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= KCC000290A_C01 KCC000290A_c01
         (1061 letters)

Database: nr 
           1,537,769 sequences; 498,525,298 total letters

Searching..................................................done

                                                                   Score     E
Sequences producing significant alignments:                        (bits)  Value

gb|AAD55568.1|AF110786_1 light harvesting complex a protein [Vol...   256  4e-67
gb|AAO16495.1| light-harvesting complex I protein [Chlamydomonas...    88  6e-54
gb|AAF90200.1|AF287276_2 chlorophyll a/b-binding protein precurs...    84  3e-41
pir||S31863 chlorophyll a/b-binding protein type 4, photosystem ...    75  3e-40
pir||S31864 chlorophyll a/b-binding protein type 4, photosystem ...    75  3e-40

>gb|AAD55568.1|AF110786_1 light harvesting complex a protein [Volvox carteri f. nagariensis]
          Length = 243

 Score =  256 bits (655), Expect = 4e-67
 Identities = 143/248 (57%), Positives = 162/248 (64%), Gaps = 4/248 (1%)
 Frame = +1

Query: 31  MALTMKRSGVAARSASSRKSVVTCVARQSWLPGSQIPAHLDTPAAQALAGNFGFDPLGLG 210
           MAL MKRS VAAR A SRK+VVTCVARQSWLPGS+IP HLD+PAA A+AGNFGFDPLGLG
Sbjct: 1   MALMMKRSAVAARPAVSRKAVVTCVARQSWLPGSEIPKHLDSPAALAMAGNFGFDPLGLG 60

Query: 211 KDPVALRWYQQAELIHCRTAMAGVAGILIPGLLTKGWA---P*TCLSGTTPARWR-SRTR 378
           KD  ALRWYQQAEL+H RTAM  VAGILIPGLLTK  A   P    +G        +   
Sbjct: 61  KDAEALRWYQQAELVHARTAMTAVAGILIPGLLTKAGALNVPEWYDAGKVAIESSFAPFG 120

Query: 379 SLPGALCWLCSCSCAASWRPSAGRTSASPAASASLARSCASRRP*RAPRSWATPAAPSTP 558
           +L     +L     A  W     +    P + A                    P     P
Sbjct: 121 ALLAVQLFLTGFVEAKRW-----QDFKKPGSQAEKGSFLGFETAFAGTGDNGYPGGIFDP 175

Query: 559 LACPREADKWADWKLKEVKNGRLAMLAFLGFVAQKYATGAGPVDNLAAHLKDPWHVNYAT 738
           L   ++ADK ADWKLKE+KNGRLAM+AFLGF AQK+ATG GP+DNLAAHL DPWHVNYA+
Sbjct: 176 LGLSKDADKLADWKLKEIKNGRLAMVAFLGFTAQKFATGKGPIDNLAAHLADPWHVNYAS 235

Query: 739 NGVSLPFL 762
           NGVS+PFL
Sbjct: 236 NGVSVPFL 243

 Score =  141 bits (355), Expect = 2e-32
 Identities = 67/84 (79%), Positives = 73/84 (86%)
 Frame = +3

Query: 321 GALNVPEWYDAGKVAIENSFAPWGSLLAVQLFLCGFVEAKRWQDIRKPGSQCEPGSFLCF 500
           GALNVPEWYDAGKVAIE+SFAP+G+LLAVQLFL GFVEAKRWQD +KPGSQ E GSFL F
Sbjct: 97  GALNVPEWYDAGKVAIESSFAPFGALLAVQLFLTGFVEAKRWQDFKKPGSQAEKGSFLGF 156

Query: 501 EASLKGTSELGYPGGPFDPLGLSK 572
           E +  GT + GYPGG FDPLGLSK
Sbjct: 157 ETAFAGTGDNGYPGGIFDPLGLSK 180

>gb|AAO16495.1| light-harvesting complex I protein [Chlamydomonas reinhardtii]
          Length = 241

 Score = 87.8 bits (216), Expect(3) = 6e-54
 Identities = 44/84 (52%), Positives = 56/84 (66%), Gaps = 1/84 (1%)
 Frame = +3

Query: 327 LNVPEWYDAGKVAIENSFAPWGSLLAVQLFLCGFVEAKRWQDIRKPGSQCEPGSFLCFEA 506
           L  PEWYDAGKV +E +   + +L+ +Q +L G+ E KRW D + PGSQ + GSFL F  
Sbjct: 97  LGFPEWYDAGKVVVEKNNIDFPTLMVIQFYLMGWAETKRWYDFKNPGSQAD-GSFLGFTE 155

Query: 507 SLKGTSELGYPGGP-FDPLGLSKG 575
             KG  E GYPGG  FDP+GLS+G
Sbjct: 156 EFKGL-ENGYPGGRFFDPMGLSRG 178

 Score = 87.8 bits (216), Expect(3) = 6e-54
 Identities = 42/61 (68%), Positives = 50/61 (81%)
 Frame = +1

Query: 574 EADKWADWKLKEVKNGRLAMLAFLGFVAQKYATGAGPVDNLAAHLKDPWHVNYATNGVSL 753
           +A K+ ++K KEVKNGRLAM+A LGF AQ  ATG GP+DNLA HL DP HVN+ATNGVS+
Sbjct: 179 DAAKYQEYKQKEVKNGRLAMIACLGFAAQYAATGKGPLDNLADHLADPNHVNFATNGVSI 238

Query: 754 P 756
           P
Sbjct: 239 P 239

 Score = 80.1 bits (196), Expect(3) = 6e-54
 Identities = 43/98 (43%), Positives = 59/98 (59%), Gaps = 3/98 (3%)
 Frame = +1

Query: 31  MALTM---KRSGVAARSASSRKSVVTCVARQSWLPGSQIPAHLDTPAAQALAGNFGFDPL 201
           MAL+M   +R+G  +   + R        R  W PG+  PAHLD     +LAG++GFDPL
Sbjct: 1   MALSMIAQRRAGAFSARQAPRAVRAQAAVRPVWFPGNPPPAHLD----GSLAGDYGFDPL 56

Query: 202 GLGKDPVALRWYQQAELIHCRTAMAGVAGILIPGLLTK 315
            LG++P  L+WY QAEL+H R AM G AGI++  +  K
Sbjct: 57  FLGQEPQTLKWYVQAELVHGRFAMLGAAGIILTSIGAK 94

>gb|AAF90200.1|AF287276_2 chlorophyll a/b-binding protein precursor [Hordeum vulgare]
          Length = 228

 Score = 84.0 bits (206), Expect(3) = 3e-41
 Identities = 47/88 (53%), Positives = 60/88 (67%)
 Frame = +1

Query: 52  SGVAARSASSRKSVVTCVARQSWLPGSQIPAHLDTPAAQALAGNFGFDPLGLGKDPVALR 231
           SG    + S+R+ V    A+ SWLPG Q PA+LD     +LAG+ GFDPL L +DP  LR
Sbjct: 11  SGRVGLAKSTRRDVAV-QAKGSWLPGLQSPAYLDG----SLAGDNGFDPLALAEDPEDLR 65

Query: 232 WYQQAELIHCRTAMAGVAGILIPGLLTK 315
           W+ QAEL++ R AM GVAG+LIP +LTK
Sbjct: 66  WFVQAELVNGRWAMLGVAGMLIPEVLTK 93

 Score = 66.6 bits (161), Expect(3) = 3e-41
 Identities = 35/83 (42%), Positives = 45/83 (54%)
 Frame = +3

Query: 321 GALNVPEWYDAGKVAIENSFAPWGSLLAVQLFLCGFVEAKRWQDIRKPGSQCEPGSFLCF 500
           G LN PEWYDAGK   E  FA   +L  ++  L  +VE +RWQDI+ PGS  +   F  +
Sbjct: 95  GLLNAPEWYDAGK---ETYFASSSTLFVIEFILFHYVEIRRWQDIKNPGSVNQDPIFKSY 151

Query: 501 EASLKGTSELGYPGGPFDPLGLS 569
                   E GYPG  F+PL  +
Sbjct: 152 SLP---PHECGYPGSVFNPLNFA 171

 Score = 62.4 bits (150), Expect(3) = 3e-41
 Identities = 28/42 (66%), Positives = 31/42 (73%)
 Frame = +1

Query: 598 KLKEVKNGRLAMLAFLGFVAQKYATGAGPVDNLAAHLKDPWH 723
           K KE+ NGRLAMLAFLGF+ Q   TG GP +NL  HL DPWH
Sbjct: 177 KEKELANGRLAMLAFLGFLVQHNVTGKGPFENLQQHLADPWH 218

>pir||S31863 chlorophyll a/b-binding protein type 4, photosystem I - Scotch pine
           gi|22753|emb|CAA78932.1| Lhca4 protein,Type 4 protein of
           light-harvesting complex of photosystem I [Pinus
           sylvestris]
          Length = 251

 Score = 74.7 bits (182), Expect(3) = 3e-40
 Identities = 37/69 (53%), Positives = 50/69 (71%)
 Frame = +1

Query: 106 ARQSWLPGSQIPAHLDTPAAQALAGNFGFDPLGLGKDPVALRWYQQAELIHCRTAMAGVA 285
           A+  WLPG   P++L+     +L G+ GFDPLGL +DP +L+WY QAEL++ R AM GVA
Sbjct: 51  AKGEWLPGLSSPSYLNG----SLPGDNGFDPLGLAEDPESLKWYVQAELVNGRWAMLGVA 106

Query: 286 GILIPGLLT 312
           G+LIP +LT
Sbjct: 107 GMLIPEVLT 115

 Score = 69.3 bits (168), Expect(3) = 3e-40
 Identities = 36/84 (42%), Positives = 50/84 (58%)
 Frame = +3

Query: 318 LGALNVPEWYDAGKVAIENSFAPWGSLLAVQLFLCGFVEAKRWQDIRKPGSQCEPGSFLC 497
           +G +NVP+WYDAGKV     FA   +L  ++  L  +VE +RWQDI+ PGS  +   F  
Sbjct: 117 IGLINVPKWYDAGKVEY---FASSSTLFVIEFILFHYVELRRWQDIKYPGSVNQDPLFKQ 173

Query: 498 FEASLKGTSELGYPGGPFDPLGLS 569
           +       +E+GYPGG F+PL  S
Sbjct: 174 YSLP---PNEVGYPGGIFNPLNFS 194

 Score = 65.5 bits (158), Expect(3) = 3e-40
 Identities = 30/42 (71%), Positives = 31/42 (73%)
 Frame = +1

Query: 598 KLKEVKNGRLAMLAFLGFVAQKYATGAGPVDNLAAHLKDPWH 723
           K KE+ NGRLAMLAFLGFV Q   TG GP DNL  HL DPWH
Sbjct: 200 KEKELANGRLAMLAFLGFVVQHNVTGKGPFDNLLQHLSDPWH 241

>pir||S31864 chlorophyll a/b-binding protein type 4, photosystem I - Scotch pine
           (fragment) gi|829287|emb|CAA78901.1| Lhca4 protein,Type
           4 protein of light-harvesting complex of photosystem I
           [Pinus sylvestris]
          Length = 244

 Score = 74.7 bits (182), Expect(3) = 3e-40
 Identities = 37/69 (53%), Positives = 50/69 (71%)
 Frame = +1

Query: 106 ARQSWLPGSQIPAHLDTPAAQALAGNFGFDPLGLGKDPVALRWYQQAELIHCRTAMAGVA 285
           A+  WLPG   P++L+     +L G+ GFDPLGL +DP +L+WY QAEL++ R AM GVA
Sbjct: 44  AKGEWLPGLSSPSYLNG----SLPGDNGFDPLGLAEDPESLKWYVQAELVNGRWAMLGVA 99

Query: 286 GILIPGLLT 312
           G+LIP +LT
Sbjct: 100 GMLIPEVLT 108

 Score = 69.3 bits (168), Expect(3) = 3e-40
 Identities = 36/84 (42%), Positives = 50/84 (58%)
 Frame = +3

Query: 318 LGALNVPEWYDAGKVAIENSFAPWGSLLAVQLFLCGFVEAKRWQDIRKPGSQCEPGSFLC 497
           +G +NVP+WYDAGKV     FA   +L  ++  L  +VE +RWQDI+ PGS  +   F  
Sbjct: 110 IGLINVPKWYDAGKVEY---FASSSTLFVIEFILFHYVELRRWQDIKYPGSVNQDPLFKQ 166

Query: 498 FEASLKGTSELGYPGGPFDPLGLS 569
           +       +E+GYPGG F+PL  S
Sbjct: 167 YSLP---PNEVGYPGGIFNPLNFS 187

 Score = 65.5 bits (158), Expect(3) = 3e-40
 Identities = 30/42 (71%), Positives = 31/42 (73%)
 Frame = +1

Query: 598 KLKEVKNGRLAMLAFLGFVAQKYATGAGPVDNLAAHLKDPWH 723
           K KE+ NGRLAMLAFLGFV Q   TG GP DNL  HL DPWH
Sbjct: 193 KEKELANGRLAMLAFLGFVVQHNVTGKGPFDNLLQHLSDPWH 234



EST assemble image


clone accession position
1 LC026h05_r AV620790 1 642
2 HC063g07_r AV636754 7 595
3 CM099a05_r AV393095 20 634
4 MXL060a06_r BP096519 29 513
5 CL36c02_r AV395114 29 658
6 CM039e05_r AV388965 87 648
7 LC060h08_r AV623240 89 663
8 MX020h06_r BP086939 94 500
9 HC045g07_r AV635389 94 577
10 HC032g08_r AV634391 97 634
11 HC070a11_r AV637200 97 568
12 HC059c06_r AV636422 98 534
13 LC015b11_r AV619931 98 649
14 LC060b01_r AV623185 98 639
15 LC024f08_r AV620633 98 638
16 LC059a11_r AV623112 98 599
17 LC061g07_r AV623300 98 597
18 LC099a03_r AV625859 98 542
19 LC096e04_r AV625690 98 570
20 LCL073h06_r AV630136 98 497
21 CM044f11_r AV389529 100 673
22 CM048c11_r AV389101 100 421
23 CM012d04_r AV387184 100 527
24 LC030d08_r AV621047 100 644
25 CM098c10_r AV392869 100 615
26 CM084b10_r AV392635 101 535
27 LC094a07_r AV625519 102 525
28 LCL098h12_r AV631735 104 574
29 LC046b07_r AV622176 104 585
30 LC072c04_r AV624050 104 629
31 LCL028f11_r AV627569 104 595
32 LC053a12_r AV622689 104 657
33 LCL074h05_r AV630177 104 580
34 LC052g09_r AV622670 104 616
35 CM026g12_r AV387530 105 655
36 CM032g03_r AV388460 106 537
37 LC087f05_r AV625084 106 633
38 HC056b05_r AV636177 106 574
39 CM074c09_r AV391578 106 381
40 LC020d11_r AV620315 106 634
41 CL62b09_r AV396436 107 597
42 MX244d04_r BP091792 107 631
43 CM098f10_r AV392910 107 626
44 CM098f09_r AV392906 107 637
45 HC072g04_r AV637403 107 635
46 HC014a10_r AV632895 107 618
47 CM053g03_r AV389960 107 687
48 CL56a08_r AV396104 107 662
49 LC054e07_r AV622790 107 649
50 LCL054d09_r AV629209 107 594
51 MXL048e11_r BP095870 107 592
52 CM053c05_r AV389934 107 682
53 LC045d02_r AV621960 107 642
54 CM025f01_r AV388074 107 736
55 CL16h02_r AV394033 107 579
56 CM054e02_r AV389971 107 430
57 CL79g11_r AV397189 107 689
58 CM004f01_r AV386634 107 645
59 MXL006b12_r BP093287 107 424
60 CM032f07_r AV388465 107 572
61 HC088c01_r AV638584 107 659
62 HCL031d12_r AV641311 107 656
63 CM025g05_r AV388076 107 722
64 LC045a07_r AV622244 107 647
65 CM028h08_r AV387737 107 737
66 HC059a01_r AV636397 107 515
67 MXL063g03_r BP096722 107 508
68 CM068c04_r AV391043 107 741
69 CM020e01_r AV397473 107 709
70 CM029h05_r AV389336 107 740
71 CM024b01_r AV388285 107 734
72 LCL015f11_r AV626803 107 669
73 CM042e08_r AV389238 107 449
74 CM055g06_r AV390197 107 555
75 CL74d11_r AV396491 107 647
76 CL29h02_r AV394655 110 399
77 CL62e10_r AV396441 111 672
78 LCL073h12_r AV630139 111 523
79 HC002d07_r AV631975 113 571
80 LC058h06_r AV623098 113 581
81 LC011b10_r AV619643 113 671
82 CM032a02_r AV388475 114 415
83 CM093a04_r AV392964 117 671
84 HC042c04_r AV635128 118 487
85 CM097g02_r AV393230 118 578
86 CL24a01_r AV394403 122 468
87 CM075c11_r AV391660 122 647
88 CM036g07_r AV388794 122 426
89 CM077b03_r AV391762 123 387
90 LC084e08_r AV624920 124 640
91 CM059c08_r AV390672 169 629
92 MX207h04_r BP089469 172 541
93 HCL045c07_r AV642084 217 527
94 CL67b10_r AV396707 219 766
95 CM075g01_r AV391590 616 1231
96 LCL030a02_r AV627646 630 959
97 CL22g02_r AV394230 638 1158
98 CM023f03_r AV387745 662 1267
99 CM090f12_r AV392328 761 1088
100 HC023c08_r AV633637 769 1235
101 LCL013e01_r AV626673 807 1236
102 HCL001e05_r AV639589 913 1187
103 CM042c08_r AV389237 962 1210




Chlamydomonas reinhardtii
Kazusa DNA Research Institute
Department of Plant Gene Research